DY259992
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of DY259992 vs. ExPASy Swiss-Prot
Match: RL15_BRUPA (60S ribosomal protein L15 (Fragment) OS=Brugia pahangi PE=3 SV=2) HSP 1 Score: 88.1965 bits (217), Expect = 9.469e-17 Identity = 37/57 (64.91%), Postives = 49/57 (85.96%), Query Frame = 1 Query: 34 MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQ 204 MGAY+Y+ ELWRKK+S+ MR+L R+RCW+YRQ +I RV+RPTRP+KARRLGY + + Sbjct: 1 MGAYRYMQELWRKKKSETMRYLLRIRCWQYRQLTAIHRVSRPTRPEKARRLGYLSNE 57
BLAST of DY259992 vs. ExPASy Swiss-Prot
Match: RL15_BRANA (60S ribosomal protein L15 (Fragment) OS=Brassica napus GN=RPL15 PE=3 SV=1) HSP 1 Score: 78.9518 bits (193), Expect = 2.569e-14 Identity = 35/39 (89.74%), Postives = 37/39 (94.87%), Query Frame = 1 Query: 88 MRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQ 204 MRF+QRVRCWEYRQ PSIVR+ RPTRPDKARRLGYKAKQ Sbjct: 3 MRFVQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQ 41 HSP 2 Score: 21.1718 bits (43), Expect = 2.569e-14 Identity = 9/12 (75.00%), Postives = 10/12 (83.33%), Query Frame = 2 Query: 260 PRVLYMVNRQTR 295 P+VL MVN QTR Sbjct: 60 PKVLCMVNPQTR 71 The following BLAST results are available for this feature:
BLAST of DY259992 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 92
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >DY259992 ID=DY259992; Name=DY259992; organism=Citrus clementina; type=EST; length=1107bpback to top |