DY260181
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of DY260181 vs. ExPASy Swiss-Prot
Match: SDC10_HUMAN (Peptidyl-prolyl cis-trans isomerase SDCCAG10 OS=Homo sapiens GN=SDCCAG10 PE=1 SV=1) HSP 1 Score: 43.1282 bits (100), Expect = 7.538e-11 Identity = 27/76 (35.53%), Postives = 35/76 (46.05%), Query Frame = 1 Query: 43 QSKMPNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKSGKPLHYKGSSFHRVIPGFMCQGGD 270 Q N KV T AG I +EL++ P+ NF LC +Y + FHRV+PGF+ QGGD Sbjct: 7 QEPPTNGKVLLKTT-----AGDIDIELWSKEAPKACRNFIQLCL----------EAYYDNTIFHRVVPGFIVQGGD 67 HSP 2 Score: 36.5798 bits (83), Expect = 7.538e-11 Identity = 18/36 (50.00%), Postives = 25/36 (69.44%), Query Frame = 2 Query: 281 GNGTGGESIYGSKFADENFVK-KHTGPGILSMANAG 385 G G+GGESIYG+ F DE + + G+++MANAG Sbjct: 70 GTGSGGESIYGAPFKDEFHSRLRFNRRGLVAMANAG 105 HSP 3 Score: 28.1054 bits (61), Expect = 7.538e-11 Identity = 11/25 (44.00%), Postives = 16/25 (64.00%), Query Frame = 3 Query: 396 NGSQFFVRTAKTEWLDGKHVVFRQV 470 NGSQFF + + L+ KH +F +V Sbjct: 109 NGSQFFFTLGRADELNNKHTIFGKV 133 The following BLAST results are available for this feature:
BLAST of DY260181 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 211
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >DY260181 ID=DY260181; Name=DY260181; organism=Citrus clementina; type=EST; length=1081bpback to top |