DY304740
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of DY304740 vs. ExPASy Swiss-Prot
Match: CB23_PEA (Chlorophyll a-b binding protein 3, chloroplastic OS=Pisum sativum GN=lhca3 PE=1 SV=1) HSP 1 Score: 77.411 bits (189), Expect = 1.020e-14 Identity = 35/41 (85.37%), Postives = 37/41 (90.24%), Query Frame = 2 Query: 683 SLAGDYGFYPLGLSDPESTGGFIEPKWLAYREVINGRYAML 805 SL GDYGF PLGLSDPE TGGFIEP+WLAY EVINGR+AML Sbjct: 71 SLPGDYGFDPLGLSDPEGTGGFIEPRWLAYGEVINGRFAML 111 HSP 2 Score: 23.8682 bits (50), Expect = 1.020e-14 Identity = 9/14 (64.29%), Postives = 9/14 (64.29%), Query Frame = 3 Query: 861 ENALGWVPNGVIPP 902 E AL W GVIPP Sbjct: 131 ETALAWFQTGVIPP 144
BLAST of DY304740 vs. ExPASy Swiss-Prot
Match: CB13_SOLLC (Chlorophyll a-b binding protein 8, chloroplastic OS=Solanum lycopersicum GN=CAB8 PE=3 SV=1) HSP 1 Score: 75.485 bits (184), Expect = 3.778e-14 Identity = 34/40 (85.00%), Postives = 36/40 (90.00%), Query Frame = 2 Query: 686 LAGDYGFYPLGLSDPESTGGFIEPKWLAYREVINGRYAML 805 L GD+GF PLGLSDPE TGGFIEPKWLAY EVINGR+AML Sbjct: 70 LPGDFGFDPLGLSDPEGTGGFIEPKWLAYGEVINGRFAML 109 HSP 2 Score: 23.8682 bits (50), Expect = 3.778e-14 Identity = 9/14 (64.29%), Postives = 9/14 (64.29%), Query Frame = 3 Query: 861 ENALGWVPNGVIPP 902 E AL W GVIPP Sbjct: 129 ETALAWFQTGVIPP 142 The following BLAST results are available for this feature:
BLAST of DY304740 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 2
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >DY304740 ID=DY304740; Name=DY304740; organism=Citrus clementina; type=EST; length=903bpback to top |