FC870853
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FC870853 vs. ExPASy Swiss-Prot
Match: HUMS_ARATH (Alpha-humulene/(-)-(E)-beta-caryophyllene synthase OS=Arabidopsis thaliana GN=TPS21 PE=2 SV=2) HSP 1 Score: 81.2629 bits (199), Expect = 1.752e-15 Identity = 36/63 (57.14%), Postives = 49/63 (77.78%), Query Frame = 2 Query: 23 VSNAWKDINEECLRPTLVPVPLLMRILNLTRAADVVYKYKDGYTDTEELKDFIASLLINPVPI 211 VS+AWKD+N+E +RP + P PLLMR+LNL+R DV Y+Y+D YT+ + LK+ I SLLI +PI Sbjct: 485 VSDAWKDLNQELMRPHVFPFPLLMRVLNLSRVIDVFYRYQDAYTNPKLLKEHIVSLLIETIPI 547
BLAST of FC870853 vs. ExPASy Swiss-Prot
Match: CASS_RICCO (Casbene synthase, chloroplastic OS=Ricinus communis PE=1 SV=1) HSP 1 Score: 78.9518 bits (193), Expect = 8.698e-15 Identity = 34/66 (51.52%), Postives = 48/66 (72.73%), Query Frame = 2 Query: 14 RKQVSNAWKDINEECLRPTLVPVPLLMRILNLTRAADVVYKYKDGYTDTEELKDFIASLLINPVPI 211 +K ++ WK+INEEC+R + V V LMRI+NL R DV YKY DGYTD+++LK F+ L ++P+ I Sbjct: 536 QKMATDCWKEINEECMRQSQVSVGHLMRIVNLARLTDVSYKYGDGYTDSQQLKQFVKGLFVDPISI 601
BLAST of FC870853 vs. ExPASy Swiss-Prot
Match: DCS3_GOSAR ((+)-delta-cadinene synthase isozyme A OS=Gossypium arboreum GN=CAD1-A PE=2 SV=1) HSP 1 Score: 72.7886 bits (177), Expect = 6.233e-13 Identity = 35/70 (50.00%), Postives = 48/70 (68.57%), Query Frame = 2 Query: 5 SEFRKQVSNAWKDINEECLRPTLVPVPLLMRILNLTRAADVVYKYKDGYTDT-EELKDFIASLLINPVPI 211 +EF K + ++WKD+NEE L+PT +P P+L R LNL R DV+Y+ DGYT + K I SLLI+P+ I Sbjct: 486 NEFNKHIESSWKDVNEEFLKPTEMPTPVLCRSLNLARVMDVLYREGDGYTHVGKAAKGGITSLLIDPIQI 555
BLAST of FC870853 vs. ExPASy Swiss-Prot
Match: DCS2_GOSAR ((+)-delta-cadinene synthase isozyme XC14 OS=Gossypium arboreum PE=2 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 9.951e-11 Identity = 34/68 (50.00%), Postives = 44/68 (64.71%), Query Frame = 2 Query: 11 FRKQVSNAWKDINEECLRPTLVPVPLLMRILNLTRAADVVYKYKDGYTDT-EELKDFIASLLINPVPI 211 F K V +AWKD+N+E L+PT +P +L R LNL R DV+Y+ DGYT + K I SLLI PV + Sbjct: 487 FNKHVESAWKDVNKEFLKPTEMPTEVLNRSLNLARVMDVLYREGDGYTYVGKAAKGGITSLLIEPVAL 554 The following BLAST results are available for this feature:
BLAST of FC870853 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 4
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FC870853 ID=FC870853; Name=FC870853; organism=Citrus clementina; type=EST; length=425bpback to top |