FC875266

Overview
NameFC875266
Unique NameFC875266
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length673
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC875266_ssr29 microsatellite FC875266_ssr29:29..44. BLAST: Citrus ESTs to Prunus persica proteins V1
FC875266_ssr130 microsatellite FC875266_ssr130:130..141. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig10192 contig Ccv1_Contig10192:1..673. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875266 vs. ExPASy Swiss-Prot
Match: ATL3B_ARATH (RING-H2 finger protein ATL3B OS=Arabidopsis thaliana GN=ATL3B PE=1 SV=2)

HSP 1 Score: 164.466 bits (415), Expect = 4.696e-40
Identity = 85/162 (52.47%), Postives = 98/162 (60.49%), Query Frame = 1
Query:  187 SPESPGSVD-PYSNMKFSPXXXXXXXXXXXXXXXMGFFSIYIRHCSDSSNS-VIXXXXXXXXXXXXXXXXXLDREVIDTFPTFVYSDVKTLKVGKGALECAVCLNEFEDDETLRLIPKCDHVFHPECIDAWLESHTTCPVCRSNLAS--------EPGETTP 642
            S   PG  + PY+  + SP               MGFFSIY RHCS   ++ V                  LD  V++TFPTF+YSDVKT K+GKG LECA+CLNEFEDDETLRL+PKCDHVFHP CIDAWLE+H TCPVCR+NLA         EPG T P
Sbjct:   29 SQSQPGPTNQPYNYGRLSPAMAVIVVILIAALFFMGFFSIYFRHCSGVPDAGVSPAGGARSRATVNAAARGLDVSVVETFPTFLYSDVKTQKLGKGELECAICLNEFEDDETLRLLPKCDHVFHPHCIDAWLEAHVTCPVCRANLAEQVAEGESVEPGGTEP 190          
BLAST of FC875266 vs. ExPASy Swiss-Prot
Match: ATL5H_ARATH (RING-H2 finger protein ATL5H OS=Arabidopsis thaliana GN=ATL5H PE=2 SV=2)

HSP 1 Score: 162.925 bits (411), Expect = 1.366e-39
Identity = 81/148 (54.73%), Postives = 95/148 (64.19%), Query Frame = 1
Query:  211 DPYS-NMKFSPXXXXXXXXXXXXXXXMGFFSIYIRHCSDS-SNSVIXXXXXXXXXXXXXXXXXLDREVIDTFPTFVYSDVKTLKVGKGALECAVCLNEFEDDETLRLIPKCDHVFHPECIDAWLESHTTCPVCRSNLASEPGETTPQP 648
            DPY+ +   SP               MGFF++YIRHC+ +   SV                  LD E I+TFPTFVYS+VKT K+GKGALECA+CLNEFEDDETLRL+PKCDHVFHP CI AWL+ H TCPVCR+NLA    E TP+P
Sbjct:   33 DPYAYSGSLSPAMAVVVVVVIAALFFMGFFTVYIRHCTGAVDGSVTPAGGARRRVTNATVARGLDAETIETFPTFVYSEVKTQKIGKGALECAICLNEFEDDETLRLLPKCDHVFHPHCIGAWLQGHVTCPVCRTNLA----EQTPEP 176          
BLAST of FC875266 vs. ExPASy Swiss-Prot
Match: ATL1N_ARATH (RING-H2 finger protein ATL1N OS=Arabidopsis thaliana GN=ATL1N PE=2 SV=2)

HSP 1 Score: 144.436 bits (363), Expect = 5.029e-34
Identity = 69/120 (57.50%), Postives = 82/120 (68.33%), Query Frame = 1
Query:  286 MGFFSIYIRHCSDSSNSVIXXXXXXXXXXXXXXXXX---LDREVIDTFPTFVYSDVKTLKVGKGALECAVCLNEFEDDETLRLIPKCDHVFHPECIDAWLESHTTCPVCRSNLASEPGET 636
            +GFFS+YIR C +    +                     LD  +I+TFPTF YS VKTL++GK ALEC+VCLNEFEDDETLRLIPKC HVFHP CIDAWL SHTTCP+CR++L   PGE+
Sbjct:   77 LGFFSVYIRRCLERVMGMDYGNPNDAGNWLATNRQQARGLDASIIETFPTFQYSTVKTLRIGKEALECSVCLNEFEDDETLRLIPKCCHVFHPGCIDAWLRSHTTCPLCRADLIPVPGES 196          
BLAST of FC875266 vs. ExPASy Swiss-Prot
Match: ATL1C_ARATH (RING-H2 finger protein ATL1C OS=Arabidopsis thaliana GN=ATL1C PE=1 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 4.707e-32
Identity = 70/143 (48.95%), Postives = 82/143 (57.34%), Query Frame = 1
Query:  211 DPYSNMKFSPXXXXXXXXXXXXXXXMGFFSIYIRHCSDSSNSV-IXXXXXXXXXXXXXXXXXLDREVIDTFPTFVYSDVKTLKVGKGALECAVCLNEFEDDETLRLIPKCDHVFHPECIDAWLESHTTCPVCRSNLASEPGET 636
            D      FSP               +G  S+Y+R C   +  +                   LD  VI+TFPTF YS VKTL++GK ALEC VCLNEFEDDETLRLIP+C HVFHP CIDAWL S TTCP+CR+NL   PGE+
Sbjct:   28 DDEGRTSFSPTTAIIMIVLVSVFFALGCISVYMRRCLQHALGMDSGGGPGNWLNVRQTTEPGLDASVIETFPTFPYSTVKTLRIGKEALECPVCLNEFEDDETLRLIPQCCHVFHPGCIDAWLRSQTTCPLCRANLVPVPGES 170          
BLAST of FC875266 vs. ExPASy Swiss-Prot
Match: ATL4C_ARATH (Putative RING-H2 finger protein ATL4C OS=Arabidopsis thaliana GN=ATL4C PE=3 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 3.730e-29
Identity = 53/83 (63.86%), Postives = 69/83 (83.13%), Query Frame = 1
Query:  394 LDREVIDTFPTFVYSDVKTLKVGKGALECAVCLNEFEDDETLRLIPKCDHVFHPECIDAWLESHTTCPVCRSNLASEPGETTP 642
            L++EVI++FPTF+YS+VK LK+GKG +ECA+CL+EFED ETLR +P C H FH  CID WL S +TCPVCR+NL+ +PGE+ P
Sbjct:   95 LEKEVIESFPTFLYSEVKGLKIGKGGVECAICLSEFEDQETLRWMPPCSHTFHANCIDVWLSSWSTCPVCRANLSLKPGESYP 177          
BLAST of FC875266 vs. ExPASy Swiss-Prot
Match: ATL4O_ARATH (RING-H2 finger protein ATL4O OS=Arabidopsis thaliana GN=ATL4O PE=2 SV=2)

HSP 1 Score: 124.02 bits (310), Expect = 7.034e-28
Identity = 57/118 (48.31%), Postives = 74/118 (62.71%), Query Frame = 1
Query:  289 GFFSIYIRHCSDSSNSVIXXXXXXXXXXXXXXXXXLDREVIDTFPTFVYSDVKTLKVGKGALECAVCLNEFEDDETLRLIPKCDHVFHPECIDAWLESHTTCPVCRSNL---ASEPGE 633
            G  S+YIRHC+ S+                     LD  V+++FP F YS VK  K+G   LECA+CLNE ED ET+RL+P C+H+FH +CID WL SH TCPVCRSNL   +++PG+
Sbjct:   60 GLLSVYIRHCARSNPDSSTRYFRNRANDGSSRRGGLDNAVVESFPVFAYSSVKESKIGSKDLECAICLNELEDHETVRLLPICNHLFHIDCIDTWLYSHATCPVCRSNLTAKSNKPGD 177          
BLAST of FC875266 vs. ExPASy Swiss-Prot
Match: ATL4B_ARATH (Putative RING-H2 finger protein ATL4B OS=Arabidopsis thaliana GN=ATL4B PE=2 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 1.567e-27
Identity = 49/85 (57.65%), Postives = 67/85 (78.82%), Query Frame = 1
Query:  394 LDREVIDTFPTFVYSDVKTLKVGKGALECAVCLNEFEDDETLRLIPKCDHVFHPECIDAWLESHTTCPVCRSNLASEPGETTPQP 648
            L++E++++FP F+YS+VK LK+GKG +ECA+CL+EF D ETLR +P C H FH  CID WL S +TCP CR+NL+ +PGE+ P P
Sbjct:   95 LEKELVESFPIFLYSEVKGLKIGKGGVECAICLSEFVDKETLRWMPPCSHTFHANCIDVWLSSQSTCPACRANLSLKPGESYPYP 179          
BLAST of FC875266 vs. ExPASy Swiss-Prot
Match: ATL1H_ARATH (RING-H2 finger protein ATL1H OS=Arabidopsis thaliana GN=ATL1H PE=2 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 2.047e-27
Identity = 50/79 (63.29%), Postives = 65/79 (82.28%), Query Frame = 1
Query:  394 LDREVIDTFPTFVYSDVKTLKVGKGALECAVCLNEFEDDETLRLIPKCDHVFHPECIDAWLESHTTCPVCRSNLASEPG 630
            L ++VI++FP+F+YS VK LK+GKG +ECA+CLNEFED+ETLRL+P C H FH  CID WL S +TCPVCR++L  +PG
Sbjct:  100 LGKDVINSFPSFLYSQVKGLKIGKGGVECAICLNEFEDEETLRLMPPCSHAFHASCIDVWLSSRSTCPVCRASLPPKPG 178          
BLAST of FC875266 vs. ExPASy Swiss-Prot
Match: ATL2G_ARATH (RING-H2 finger protein ATL2G OS=Arabidopsis thaliana GN=ATL2G PE=2 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 4.559e-27
Identity = 49/74 (66.22%), Postives = 63/74 (85.14%), Query Frame = 1
Query:  394 LDREVIDTFPTFVYSDVKTLKVGKGALECAVCLNEFEDDETLRLIPKCDHVFHPECIDAWLESHTTCPVCRSNL 615
            LD E I+TFPTF+YS+VK +++GKG +ECAVCL EFEDDETLRL+P C HVFH +C+D WL  H+TCP+CR++L
Sbjct:  107 LDAEAIETFPTFLYSEVKAVRIGKGGVECAVCLCEFEDDETLRLMPPCCHVFHADCVDVWLSEHSTCPLCRADL 180          
BLAST of FC875266 vs. ExPASy Swiss-Prot
Match: ATL4D_ARATH (Putative RING-H2 finger protein ATL4D OS=Arabidopsis thaliana GN=ATL4D PE=2 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 7.777e-27
Identity = 48/86 (55.81%), Postives = 66/86 (76.74%), Query Frame = 1
Query:  394 LDREVIDTFPTFVYSDVKTLKVGKGALECAVCLNEFEDDETLRLIPKCDHVFHPECIDAWLESHTTCPVCRSNLASEPGETTPQPS 651
            +D++VI++FP F+YS+VK  K+G G +ECA+CL EFED+E LR +P C H FH  CID WL S +TCPVCR+NL+ + G++ P PS
Sbjct:   92 IDKDVIESFPAFLYSEVKAFKIGNGGVECAICLCEFEDEEPLRWMPPCSHTFHANCIDEWLSSRSTCPVCRANLSLKSGDSFPHPS 177          
The following BLAST results are available for this feature:
BLAST of FC875266 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 73
Match NameE-valueIdentityDescription
ATL3B_ARATH4.696e-4052.47RING-H2 finger protein ATL3B OS=Arabidopsis thalia... [more]
ATL5H_ARATH1.366e-3954.73RING-H2 finger protein ATL5H OS=Arabidopsis thalia... [more]
ATL1N_ARATH5.029e-3457.50RING-H2 finger protein ATL1N OS=Arabidopsis thalia... [more]
ATL1C_ARATH4.707e-3248.95RING-H2 finger protein ATL1C OS=Arabidopsis thalia... [more]
ATL4C_ARATH3.730e-2963.86Putative RING-H2 finger protein ATL4C OS=Arabidops... [more]
ATL4O_ARATH7.034e-2848.31RING-H2 finger protein ATL4O OS=Arabidopsis thalia... [more]
ATL4B_ARATH1.567e-2757.65Putative RING-H2 finger protein ATL4B OS=Arabidops... [more]
ATL1H_ARATH2.047e-2763.29RING-H2 finger protein ATL1H OS=Arabidopsis thalia... [more]
ATL2G_ARATH4.559e-2766.22RING-H2 finger protein ATL2G OS=Arabidopsis thalia... [more]
ATL4D_ARATH7.777e-2755.81Putative RING-H2 finger protein ATL4D OS=Arabidops... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31402A10EF CTVClemen1 Citrus clementina cDNA clone C31402A10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875266 ID=FC875266|Name=FC875266|organism=Citrus clementina|type=EST|length=673bp
GATTTTCACAAATCTCACCGCCTCCTTGCTCTCTCTCTCTCTCTTTCCAA
CTCTCTCTCCACATCTCATGCAATAATGGGGTCACGACTCTTACCCTACT
CCGCGAAACATGGGACCAATCCCCTTTCTCTCCTCCTCCTCATGCTCCTC
GTCGCCAACGCGCTCCCCCTCCCGCTCGCCCAGCGCAGCCCCGAGTCCCC
GGGCTCCGTCGACCCCTACTCCAACATGAAATTCAGCCCCTCACTCGCCA
TAATAATCGTCGTGTTGATTTCGGCTCTCTTCTTCATGGGCTTCTTCTCC
ATCTACATCCGCCACTGCTCCGACTCCAGCAACTCCGTCATCCGCCCCTC
CGGCGCCGGAGGCAACCGCTCCAGGCGCGGCGCCGCCCGTGGCCTCGACC
GCGAGGTCATCGACACTTTCCCGACCTTCGTCTACTCCGACGTCAAGACG
CTGAAGGTCGGCAAAGGCGCGCTCGAGTGCGCCGTCTGCCTGAACGAGTT
CGAGGACGACGAAACGCTGCGTTTGATCCCGAAATGCGACCACGTCTTCC
ACCCCGAGTGTATCGACGCCTGGCTTGAATCGCACACCACGTGTCCCGTT
TGCCGCTCGAATTTGGCCTCTGAACCCGGTGAGACAACTCCTCAACCCAG
TGAGCTGGGCTCATCCGAGGTGG
back to top