FC875475

Overview
NameFC875475
Unique NameFC875475
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length665
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14430 contig Ccv1_Contig14430:35..699. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875475 vs. ExPASy Swiss-Prot
Match: GCST_ARATH (Aminomethyltransferase, mitochondrial OS=Arabidopsis thaliana GN=GDCST PE=1 SV=1)

HSP 1 Score: 334.339 bits (856), Expect = 3.334e-91
Identity = 159/185 (85.95%), Postives = 177/185 (95.68%), Query Frame = 3
Query:  111 MRGGSLWQLGQSITRRLALADKKTIARRHFASDAENLKKTALHDFHVANGGKMVPFAGWSMPIQYKDSIMESTLNCRQNGSLFDVSHMCGLSLKGKDCVPFLEKLVIADVAGLAPGTGTLTVFTNENGGSIDDSVITKVKDDHIYLVVNAGCRDKDLAHIEAHMKSFTAKGGDVSWHIHDERSLL 665
            MRGGSLWQLGQSITRRLA +DKK ++RR+FAS+A+ LKKTAL+DFHVA+GGKMVPFAGWSMPIQYKDSIM+ST+NCR+NGSLFDV+HMCGLSLKGKDCVPFLE LV+ADVAGLAPGTG+LTVFTNE GG+IDDSVITKV D+HIYLVVNAGCRDKDLAHIE HMK+F +KGGDVSWHIHDERSLL
Sbjct:    1 MRGGSLWQLGQSITRRLAQSDKKVVSRRYFASEAD-LKKTALYDFHVAHGGKMVPFAGWSMPIQYKDSIMDSTVNCRENGSLFDVAHMCGLSLKGKDCVPFLETLVVADVAGLAPGTGSLTVFTNEKGGAIDDSVITKVTDEHIYLVVNAGCRDKDLAHIEEHMKAFKSKGGDVSWHIHDERSLL 184          
BLAST of FC875475 vs. ExPASy Swiss-Prot
Match: GCST_MESCR (Aminomethyltransferase, mitochondrial OS=Mesembryanthemum crystallinum GN=GDCST PE=2 SV=1)

HSP 1 Score: 331.643 bits (849), Expect = 2.161e-90
Identity = 157/185 (84.86%), Postives = 174/185 (94.05%), Query Frame = 3
Query:  111 MRGGSLWQLGQSITRRLALADKKTIARRHFASDAENLKKTALHDFHVANGGKMVPFAGWSMPIQYKDSIMESTLNCRQNGSLFDVSHMCGLSLKGKDCVPFLEKLVIADVAGLAPGTGTLTVFTNENGGSIDDSVITKVKDDHIYLVVNAGCRDKDLAHIEAHMKSFTAKGGDVSWHIHDERSLL 665
            MRGG LWQLGQS+TRRLA A+KK IARR FAS+A+ LKKTAL+DFHVANGGKMVPFAGWSMPIQYKDSIM+ST+NCR+NGSLFDV+HMCGLSLKGKDC+PFLEKLV+ D+AGLAPGTGTL+V TNE GG+IDD+VITKV DDHIYLVVNAGCR+KDLAHIE HMK+F AKGGDVSWHIHDERSLL
Sbjct:    1 MRGGGLWQLGQSVTRRLAQAEKKVIARRCFASEAD-LKKTALYDFHVANGGKMVPFAGWSMPIQYKDSIMDSTINCRENGSLFDVAHMCGLSLKGKDCIPFLEKLVVGDIAGLAPGTGTLSVLTNEKGGAIDDTVITKVTDDHIYLVVNAGCREKDLAHIEEHMKAFKAKGGDVSWHIHDERSLL 184          
BLAST of FC875475 vs. ExPASy Swiss-Prot
Match: GCST_FLAPR (Aminomethyltransferase, mitochondrial OS=Flaveria pringlei GN=GDCST PE=2 SV=1)

HSP 1 Score: 330.872 bits (847), Expect = 3.686e-90
Identity = 162/185 (87.57%), Postives = 174/185 (94.05%), Query Frame = 3
Query:  111 MRGGSLWQLGQSITRRLALADKKTIARRHFASDAENLKKTALHDFHVANGGKMVPFAGWSMPIQYKDSIMESTLNCRQNGSLFDVSHMCGLSLKGKDCVPFLEKLVIADVAGLAPGTGTLTVFTNENGGSIDDSVITKVKDDHIYLVVNAGCRDKDLAHIEAHMKSFTAKGGDVSWHIHDERSLL 665
            MRGG LWQLGQSITRRL  +DKKTIARR +AS+A+ LKKT L+DFHVANGGKMVPFAGWSMPIQYKDSIMEST+NCR+NGSLFDVSHMCGLSLKGKDCVPFLEKLV+ADVAGL PGTG+LTVFTNE GG+IDDSVITKV DDHIYLVVNAGCRDKDLAHIE HMK+F AKGGDVSWHI+DERSLL
Sbjct:    1 MRGG-LWQLGQSITRRLGQSDKKTIARRCYASEAD-LKKTVLYDFHVANGGKMVPFAGWSMPIQYKDSIMESTINCRENGSLFDVSHMCGLSLKGKDCVPFLEKLVVADVAGLRPGTGSLTVFTNEKGGAIDDSVITKVTDDHIYLVVNAGCRDKDLAHIEEHMKAFKAKGGDVSWHIYDERSLL 183          
BLAST of FC875475 vs. ExPASy Swiss-Prot
Match: GCST_SOLTU (Aminomethyltransferase, mitochondrial OS=Solanum tuberosum GN=GDCST PE=2 SV=1)

HSP 1 Score: 329.717 bits (844), Expect = 8.212e-90
Identity = 162/185 (87.57%), Postives = 173/185 (93.51%), Query Frame = 3
Query:  111 MRGGSLWQLGQSITRRLALADKKTIARRHFASDAENLKKTALHDFHVANGGKMVPFAGWSMPIQYKDSIMESTLNCRQNGSLFDVSHMCGLSLKGKDCVPFLEKLVIADVAGLAPGTGTLTVFTNENGGSIDDSVITKVKDDHIYLVVNAGCRDKDLAHIEAHMKSFTAKGGDVSWHIHDERSLL 665
            MRGG LWQLGQSITRRLA ADKKTI RR FASDA+ LKKT L+DFHV NGGKMVPFAGWSMPIQYKDSIM+ST+NCR+NGSLFDVSHMCGLSLKGKD +PFLEKLVIADVAGLAPGTG+LTVFTNE GG+IDDSV+TKV +DHIYLVVNAGCRDKDLAHIE HMKSF +KGGDVSWHIHDERSLL
Sbjct:    1 MRGG-LWQLGQSITRRLAQADKKTIGRRCFASDAD-LKKTVLYDFHVVNGGKMVPFAGWSMPIQYKDSIMDSTVNCRENGSLFDVSHMCGLSLKGKDTIPFLEKLVIADVAGLAPGTGSLTVFTNEKGGAIDDSVVTKVTNDHIYLVVNAGCRDKDLAHIEEHMKSFKSKGGDVSWHIHDERSLL 183          
BLAST of FC875475 vs. ExPASy Swiss-Prot
Match: GCST_FLATR (Aminomethyltransferase, mitochondrial OS=Flaveria trinervia GN=GDCST PE=3 SV=1)

HSP 1 Score: 329.717 bits (844), Expect = 8.212e-90
Identity = 161/185 (87.03%), Postives = 173/185 (93.51%), Query Frame = 3
Query:  111 MRGGSLWQLGQSITRRLALADKKTIARRHFASDAENLKKTALHDFHVANGGKMVPFAGWSMPIQYKDSIMESTLNCRQNGSLFDVSHMCGLSLKGKDCVPFLEKLVIADVAGLAPGTGTLTVFTNENGGSIDDSVITKVKDDHIYLVVNAGCRDKDLAHIEAHMKSFTAKGGDVSWHIHDERSLL 665
            MRGG LWQ+GQSITRRL  +DKKTI RR +AS+A+ LKKT L+DFHVANGGKMVPFAGWSMPIQYKDSIMEST+NCR+NGSLFDVSHMCGLSLKGKDCV FLEKLV+ADVAGLAPGTG+LTVFTNE GG+IDDSVITKV DDHIYLVVNAGCRDKDLAHIE HMK+F AKGGDVSWHIHDERSLL
Sbjct:    1 MRGG-LWQVGQSITRRLGQSDKKTIVRRWYASEAD-LKKTVLYDFHVANGGKMVPFAGWSMPIQYKDSIMESTINCRENGSLFDVSHMCGLSLKGKDCVAFLEKLVVADVAGLAPGTGSLTVFTNEKGGAIDDSVITKVTDDHIYLVVNAGCRDKDLAHIEQHMKAFKAKGGDVSWHIHDERSLL 183          
BLAST of FC875475 vs. ExPASy Swiss-Prot
Match: GCST_FLAAN (Aminomethyltransferase, mitochondrial OS=Flaveria anomala GN=GDCST PE=3 SV=1)

HSP 1 Score: 325.094 bits (832), Expect = 2.023e-88
Identity = 159/185 (85.95%), Postives = 173/185 (93.51%), Query Frame = 3
Query:  111 MRGGSLWQLGQSITRRLALADKKTIARRHFASDAENLKKTALHDFHVANGGKMVPFAGWSMPIQYKDSIMESTLNCRQNGSLFDVSHMCGLSLKGKDCVPFLEKLVIADVAGLAPGTGTLTVFTNENGGSIDDSVITKVKDDHIYLVVNAGCRDKDLAHIEAHMKSFTAKGGDVSWHIHDERSLL 665
            MRGG LWQLGQSITRRL  +DKKTI RR +AS+A+ LKKT L+DFHVA+GGKMVPFAGWSMPIQYKDSIM+ST+NCR+NGSLFDVSHMCGLSLKGKDCV FLEKLV+ADVAGLAPGTG+LTVFTNE GG+IDDSVITKV DDHIYLVVNAGCRDKDLAHIE HMK+F AKGGDVSWHI+DERSLL
Sbjct:    1 MRGG-LWQLGQSITRRLGQSDKKTIVRRCYASEAD-LKKTVLYDFHVAHGGKMVPFAGWSMPIQYKDSIMDSTINCRENGSLFDVSHMCGLSLKGKDCVAFLEKLVVADVAGLAPGTGSLTVFTNEKGGAIDDSVITKVTDDHIYLVVNAGCRDKDLAHIEEHMKAFKAKGGDVSWHIYDERSLL 183          
BLAST of FC875475 vs. ExPASy Swiss-Prot
Match: GCST_PEA (Aminomethyltransferase, mitochondrial OS=Pisum sativum GN=GDCST PE=1 SV=2)

HSP 1 Score: 316.235 bits (809), Expect = 9.396e-86
Identity = 160/186 (86.02%), Postives = 170/186 (91.40%), Query Frame = 3
Query:  111 MRGGSLWQLGQSITRRLALA-DKKTIARRHFASDAENLKKTALHDFHVANGGKMVPFAGWSMPIQYKDSIMESTLNCRQNGSLFDVSHMCGLSLKGKDCVPFLEKLVIADVAGLAPGTGTLTVFTNENGGSIDDSVITKVKDDHIYLVVNAGCRDKDLAHIEAHMKSFTAKGGDVSWHIHDERSLL 665
            MRGG LWQLGQSITRRLA   DKK +ARR FA+++E LKKT L+DFHVA+GGKMVPFAGWSMPIQYKDSIM+STLNCRQNGSLFDVSHMCGLSLKGKD V FLEKLVIADVA LA GTGTLTVFTNE GG+IDDSVITKV DDH+YLVVNAGCRDKDLAHIE HMK+F AKGGDVSWHIHDERSLL
Sbjct:    1 MRGG-LWQLGQSITRRLANGGDKKAVARRCFATESE-LKKTVLYDFHVAHGGKMVPFAGWSMPIQYKDSIMDSTLNCRQNGSLFDVSHMCGLSLKGKDVVSFLEKLVIADVAALAHGTGTLTVFTNEKGGAIDDSVITKVTDDHLYLVVNAGCRDKDLAHIEEHMKAFKAKGGDVSWHIHDERSLL 184          
BLAST of FC875475 vs. ExPASy Swiss-Prot
Match: GCST_CHICK (Aminomethyltransferase, mitochondrial OS=Gallus gallus GN=AMT PE=2 SV=2)

HSP 1 Score: 164.851 bits (416), Expect = 3.499e-40
Identity = 80/162 (49.38%), Postives = 106/162 (65.43%), Query Frame = 3
Query:  174 KKTIARRHFASDAENLKKTALHDFHVANGGKMVPFAGWSMPIQYKDSIMESTLNCRQNGSLFDVSHMCGLSLKGKDCVPFLEKLVIADVAGLAPGTGTLTVFTNENGGSIDDSVITKVKDDHIYLVVNAGCRDKDLAHIEAHMKSFTAKGGDVSWHIHDERS 659
            +  +ARRH +S  E LK+T L   H A GG+MVPFAGWS+P+QY    +ES L+ R++ SLFDVSHM    + G+D V FLE LV+ D+A L PG GTLT+ TNE G  +DD ++T   +DH+Y+V NAGC DKD A +E       A GGDV   +  +R+
Sbjct:    7 RAALARRHLSSAPEGLKQTPLDALHRARGGRMVPFAGWSLPVQYGRGHLESHLHTRRHCSLFDVSHMLQTRVYGRDRVRFLESLVVGDIAELRPGQGTLTLLTNERGDIVDDLIVTNTAEDHLYVVSNAGCADKDRAVMEGRAAELRAAGGDVHLEVSGQRA 168          
BLAST of FC875475 vs. ExPASy Swiss-Prot
Match: GCST_MOUSE (Aminomethyltransferase, mitochondrial OS=Mus musculus GN=Amt PE=2 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 9.527e-38
Identity = 74/154 (48.05%), Postives = 108/154 (70.13%), Query Frame = 3
Query:  183 IARRHFASDAENLKKTALHDFHVANGGKMVPFAGWSMPIQYKDSIMESTLNCRQNGSLFDVSHMCGLSLKGKDCVPFLEKLVIADVAGLAPGTGTLTVFTNENGGSIDDSVITKVKDDHIYLVVNAGCRDKDLAHIEAHMKSFTAKGGDVSWHI 644
            +  R  +S  + L++T L+DFH+A+GGKMV FAGWS+P+QY+DS ++S L+ R++ SLFDVSHM    + G D V  LE +V+ D+A L P  GTL++FTNE GG +DD +++   + H+Y+V NAGCRDKDLA ++  +K F  +G DV   +
Sbjct:   21 VQSRPLSSVQDVLRRTPLYDFHLAHGGKMVAFAGWSLPVQYRDSHVDSHLHTRRHCSLFDVSHMLQTKIFGCDRVKLLESVVVGDIAELRPNQGTLSLFTNEAGGILDDLIVSNTSEGHLYVVSNAGCRDKDLALMQDKVKEFQNRGLDVGLEV 174          
BLAST of FC875475 vs. ExPASy Swiss-Prot
Match: GCST_BOVIN (Aminomethyltransferase, mitochondrial OS=Bos taurus GN=AMT PE=1 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 2.772e-37
Identity = 73/148 (49.32%), Postives = 102/148 (68.92%), Query Frame = 3
Query:  219 LKKTALHDFHVANGGKMVPFAGWSMPIQYKDSIMESTLNCRQNGSLFDVSHMCGLSLKGKDCVPFLEKLVIADVAGLAPGTGTLTVFTNENGGSIDDSVITKVKDDHIYLVVNAGCRDKDLAHIEAHMKSFTAKGGDVSWHIHDERSL 662
            L +T L+DFH+A+GGKMV FAGWS+P+QY+DS + S L+ RQ+ SLFDVSHM    + G D V  +E LV+ D+A L P  GTL++FTNE GG +DD ++T   + H+Y+V NAGCR+KDL  ++  ++    KG DV+  + D   L
Sbjct:   27 LHRTPLYDFHLAHGGKMVAFAGWSLPVQYRDSHVNSHLHTRQHCSLFDVSHMLQTKIFGCDRVKLMESLVVGDIAELKPNQGTLSLFTNEAGGILDDLIVTSASEGHLYVVSNAGCREKDLTLMQDKVRELQNKGSDVALEVMDNALL 174          
The following BLAST results are available for this feature:
BLAST of FC875475 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 328
Match NameE-valueIdentityDescription
GCST_ARATH3.334e-9185.95Aminomethyltransferase, mitochondrial OS=Arabidops... [more]
GCST_MESCR2.161e-9084.86Aminomethyltransferase, mitochondrial OS=Mesembrya... [more]
GCST_FLAPR3.686e-9087.57Aminomethyltransferase, mitochondrial OS=Flaveria ... [more]
GCST_SOLTU8.212e-9087.57Aminomethyltransferase, mitochondrial OS=Solanum t... [more]
GCST_FLATR8.212e-9087.03Aminomethyltransferase, mitochondrial OS=Flaveria ... [more]
GCST_FLAAN2.023e-8885.95Aminomethyltransferase, mitochondrial OS=Flaveria ... [more]
GCST_PEA9.396e-8686.02Aminomethyltransferase, mitochondrial OS=Pisum sat... [more]
GCST_CHICK3.499e-4049.38Aminomethyltransferase, mitochondrial OS=Gallus ga... [more]
GCST_MOUSE9.527e-3848.05Aminomethyltransferase, mitochondrial OS=Mus muscu... [more]
GCST_BOVIN2.772e-3749.32Aminomethyltransferase, mitochondrial OS=Bos tauru... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31404D02EF CTVClemen1 Citrus clementina cDNA clone C31404D02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875475 ID=FC875475|Name=FC875475|organism=Citrus clementina|type=EST|length=665bp
GGATCCACCGCTCTCTCTGTGTATGCCTGGAGATGCTCTTTCGGGCTCCC
AGATTTGCTTGTTTCTGAGATAAAGAAGAAAACCCCATCTCTATATTTAT
ATCGAATAAAATGAGAGGAGGGAGTCTGTGGCAGCTTGGACAATCGATCA
CCCGTCGTTTGGCTCTGGCTGATAAGAAGACTATAGCTCGTAGACACTTT
GCCTCAGATGCTGAAAACCTGAAAAAAACTGCCCTTCATGACTTTCATGT
GGCTAATGGTGGAAAGATGGTTCCATTTGCTGGATGGAGCATGCCTATTC
AGTACAAGGACTCAATTATGGAATCTACTTTGAATTGTCGGCAGAATGGT
AGTCTCTTTGATGTCTCCCATATGTGTGGGCTGAGCCTCAAAGGGAAGGA
TTGCGTCCCTTTCCTTGAGAAGCTTGTGATCGCTGATGTTGCTGGACTTG
CCCCAGGAACTGGGACTCTTACAGTCTTTACAAATGAAAATGGGGGTTCA
ATTGATGATTCGGTTATTACCAAGGTGAAGGATGATCACATATACCTTGT
TGTGAATGCTGGCTGCAGGGATAAGGATCTTGCTCACATTGAGGCACATA
TGAAGAGTTTCACAGCCAAAGGTGGGGATGTCTCGTGGCACATCCATGAT
GAGAGATCTCTTCTT
back to top