FC875476

Overview
NameFC875476
Unique NameFC875476
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length711
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig11876 contig Ccv1_Contig11876:356..1067. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875476 vs. ExPASy Swiss-Prot
Match: A494_ARATH (Probable cysteine proteinase A494 OS=Arabidopsis thaliana GN=At2g21430 PE=2 SV=2)

HSP 1 Score: 408.297 bits (1048), Expect = 2.069e-113
Identity = 195/236 (82.63%), Postives = 217/236 (91.95%), Query Frame = 2
Query:    2 NLRRAARRQKLDPSATHGVTQFSDLTPAEFRRTYLGLRRKLRLPKDADQAPILPTNDLPADFDWREKGAVGPVKDQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHECDPEEPGSCDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGTDRGHACKFDKSKIAASVANFSVVSLDEDQIAANLVKNGPLAVAINAVYMQTYIGGVSCPYICSRRLDHGVVLVGYGSA 709
            NL RA R QK+DPSA HGVTQFSDLT +EFRR +LG++   +LPKDA+QAPILPT +LP +FDWR++GAV PVK+QGSCGSCWSFSTTGALEGA+FLATGKLVSLSEQQLVDCDHECDPEE GSCDSGCNGGLMNSAFEYTLK GGLMRE+DYPYTGTD G +CK D+SKI ASV+NFSVVS++EDQIAANL+KNGPLAVAINA YMQTYIGGVSCPYICSRRL+HGV+LVGYGSA
Sbjct:   75 NLLRAMRHQKMDPSARHGVTQFSDLTRSEFRRKHLGVKGGFKLPKDANQAPILPTQNLPEEFDWRDRGAVTPVKNQGSCGSCWSFSTTGALEGAHFLATGKLVSLSEQQLVDCDHECDPEEEGSCDSGCNGGLMNSAFEYTLKTGGLMREKDYPYTGTD-GGSCKLDRSKIVASVSNFSVVSINEDQIAANLIKNGPLAVAINAAYMQTYIGGVSCPYICSRRLNHGVLLVGYGSA 309          
BLAST of FC875476 vs. ExPASy Swiss-Prot
Match: RD19A_ARATH (Cysteine proteinase RD19a OS=Arabidopsis thaliana GN=RD19A PE=2 SV=1)

HSP 1 Score: 406.757 bits (1044), Expect = 6.020e-113
Identity = 195/236 (82.63%), Postives = 214/236 (90.68%), Query Frame = 2
Query:    2 NLRRAARRQKLDPSATHGVTQFSDLTPAEFRRTYLGLRRKLRLPKDADQAPILPTNDLPADFDWREKGAVGPVKDQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHECDPEEPGSCDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGTDRGHACKFDKSKIAASVANFSVVSLDEDQIAANLVKNGPLAVAINAVYMQTYIGGVSCPYICSRRLDHGVVLVGYGSA 709
            NLRRA R QKLDPSATHGVTQFSDLT +EFR+ +LG+R   +LPKDA++APILPT +LP DFDWR+ GAV PVK+QGSCGSCWSFS TGALEGANFLATGKLVSLSEQQLVDCDHECDPEE  SCDSGCNGGLMNSAFEYTLK GGLM+EEDYPYTG D G  CK DKSKI ASV+NFSV+S+DE+QIAANLVKNGPLAVAINA YMQTYIGGVSCPYIC+RRL+HGV+LVGYG+A
Sbjct:   78 NLRRARRHQKLDPSATHGVTQFSDLTRSEFRKKHLGVRSGFKLPKDANKAPILPTENLPEDFDWRDHGAVTPVKNQGSCGSCWSFSATGALEGANFLATGKLVSLSEQQLVDCDHECDPEEADSCDSGCNGGLMNSAFEYTLKTGGLMKEEDYPYTGKD-GKTCKLDKSKIVASVSNFSVISIDEEQIAANLVKNGPLAVAINAGYMQTYIGGVSCPYICTRRLNHGVLLVGYGAA 312          
BLAST of FC875476 vs. ExPASy Swiss-Prot
Match: CYSP_PEA (Cysteine proteinase 15A OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 370.548 bits (950), Expect = 4.781e-102
Identity = 175/235 (74.47%), Postives = 208/235 (88.51%), Query Frame = 2
Query:    2 NLRRAARRQKLDPSATHGVTQFSDLTPAEFRRTYLGLRRKLRLPKDADQAPILPTNDLPADFDWREKGAVGPVKDQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHECDPEEPGSCDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGTDRGHACKFDKSKIAASVANFSVVSLDEDQIAANLVKNGPLAVAINAVYMQTYIGGVSCPYICSR-RLDHGVVLVGYG 703
            NL +A   Q  DP+A HG+T+FSDLT +EFRR +LGL+++LRLP  A +APILPT +LP DFDWREKGAV PVKDQGSCGSCW+FSTTGALEGA++LATGKLVSLSEQQLVDCDH CDPE+ GSCDSGCNGGLMN+AFEY L++GG+++E+DY YTG D   +CKFDKSK+ ASV+NFSVV+LDEDQIAANLVKNGPLAVAINA +MQTY+ GVSCPY+C++ RLDHGV+LVG+G
Sbjct:   75 NLIKAKLHQNRDPTAEHGITKFSDLTASEFRRQFLGLKKRLRLPAHAQKAPILPTTNLPEDFDWREKGAVTPVKDQGSCGSCWAFSTTGALEGAHYLATGKLVSLSEQQLVDCDHVCDPEQAGSCDSGCNGGLMNNAFEYLLESGGVVQEKDYAYTGRD--GSCKFDKSKVVASVSNFSVVTLDEDQIAANLVKNGPLAVAINAAWMQTYMSGVSCPYVCAKSRLDHGVLLVGFG 307          
BLAST of FC875476 vs. ExPASy Swiss-Prot
Match: CYSP1_MAIZE (Cysteine proteinase 1 OS=Zea mays GN=CCP1 PE=2 SV=1)

HSP 1 Score: 366.696 bits (940), Expect = 6.904e-101
Identity = 178/241 (73.86%), Postives = 200/241 (82.99%), Query Frame = 2
Query:    2 NLRRAARRQKLDPSATHGVTQFSDLTPAEFRRTYLGLRRKLR-----LPKDADQAPILPTNDLPADFDWREKGAVGPVKDQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHECDPEEPGSCDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGTDRGHACKFDKSKIAASVANFSVVSLDEDQIAANLVKNGPLAVAINAVYMQTYIGGVSCPYICSRRLDHGVVLVGYGSA 709
            NLRRA R Q LDPSA HGVT+FSDLTPAEFRRTYLGLR+  R     L + A +AP+LPT+ LP DFDWR+ GAVGPVK+QGSCGSCWSFS +GALEGA++LATGKL  LSEQQ VDCDHECD  EP SCDSGCNGGLM +AF Y  KAGGL  E+DYPYTG+D    CKFDKSKI ASV NFSVVS+DE QI+ANL+K+GPLA+ INA YMQTYIGGVSCPYIC R LDHGV+LVGYG++
Sbjct:   75 NLRRARRHQLLDPSAEHGVTKFSDLTPAEFRRTYLGLRKSRRALLRELGESAHEAPVLPTDGLPDDFDWRDHGAVGPVKNQGSCGSCWSFSASGALEGAHYLATGKLEVLSEQQFVDCDHECDSSEPDSCDSGCNGGLMTTAFSYLQKAGGLESEKDYPYTGSD--GKCKFDKSKIVASVQNFSVVSVDEAQISANLIKHGPLAIGINAAYMQTYIGGVSCPYICGRHLDHGVLLVGYGAS 313          
BLAST of FC875476 vs. ExPASy Swiss-Prot
Match: CYSP1_DICDI (Cysteine proteinase 1 OS=Dictyostelium discoideum GN=cprA PE=1 SV=2)

HSP 1 Score: 206.068 bits (523), Expect = 1.560e-52
Identity = 105/222 (47.30%), Postives = 141/222 (63.51%), Query Frame = 2
Query:   53 GVTQFSDLTPAEFRRTYLGLRRKLRLPKDADQAPILPT---NDLPADFDWREKGAVGPVKDQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHEC-DPEEPGSCDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGTDRGHACKFDKSKIAASVANFSVVSLDEDQIAANLVKNGPLAVAINAVYMQTYIGGVSCPYICSRRLDHGVVLVGYGS 706
            GV +F+DL+  EF+  YL  +  +    D   A  L     N +P  FDWR +GAV PVK+QG CGSCWSFSTTG +EG +F++  KLVSLSEQ LVDCDHEC + E   +CD GCNGGL  +A+ Y +K GG+  E  YPYT  + G  C F+ + I A ++NF+++  +E  +A  +V  GPLA+A +AV  Q YIGGV         LDHG+++VGY +
Sbjct:   76 GVNKFADLSSDEFKNYYLNNKEAI-FTDDLPVADYLDDEFINSIPTAFDWRTRGAVTPVKNQGQCGSCWSFSTTGNVEGQHFISQNKLVSLSEQNLVDCDHECMEYEGEQACDEGCNGGLQPNAYNYIIKNGGIQTESSYPYT-AETGTQCNFNSANIGAKISNFTMIPKNETVMAGYIVSTGPLAIAADAVEWQFYIGGVFDIPCNPNSLDHGILIVGYSA 295          
BLAST of FC875476 vs. ExPASy Swiss-Prot
Match: CYSP2_DICDI (Cysteine proteinase 2 OS=Dictyostelium discoideum GN=cprB PE=2 SV=1)

HSP 1 Score: 184.882 bits (468), Expect = 3.721e-46
Identity = 105/231 (45.45%), Postives = 137/231 (59.31%), Query Frame = 2
Query:   29 KLDPSATHGVTQFSDLTPAEFRRTYLGLRRKLRLPKDADQAPILPTNDL---PADFDWREKGAVGPVKDQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHECDPEEPGSCDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGTDRGHACKFDKSKIAASVANFSVVSLDEDQIAANLVKNGPLAVAINAVY--MQTYIGGVSCPYICS-RRLDHGVVLVGYG 703
            K D     G+  F+D+T  E+R+TYLG R         D   +L   DL   P   DWR K AV P+KDQG CGSCWSFSTTG+ EGA+ L T KLVSLSEQ LVDC     PEE    + GC+GGLMN+AF+Y +K  G+  E  YPYT  + G  C F+KS I A++  +  ++   +    N  ++GP++VAI+A +   Q Y  G+     CS   LDHGV++VGYG
Sbjct:   72 KGDSQTVLGLNNFADITNEEYRKTYLGTRVNAHSYNGYDGREVLNVEDLQTNPKSIDWRTKNAVTPIKDQGQCGSCWSFSTTGSTEGAHALKTKKLVSLSEQNLVDCS---GPEE----NFGCDGGLMNNAFDYIIKNKGIDTESSYPYT-AETGSTCLFNKSDIGATIKGYVNITAGSEISLENGAQHGPVSVAIDASHNSFQLYTSGIYYEPKCSPTELDHGVLVVGYG 294          
BLAST of FC875476 vs. ExPASy Swiss-Prot
Match: CATL_SCHMA (Cathepsin L OS=Schistosoma mansoni GN=CL1 PE=2 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 7.017e-45
Identity = 103/227 (45.37%), Postives = 137/227 (60.35%), Query Frame = 2
Query:   41 SATHGVTQFSDLTPAEFRRTYLGLRRKLRLPKDADQAPIL---PTNDLPADFDWREKGAVGPVKDQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHECDPEEPGSCDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGTDRGHACKFDKSKIAASVANFSVVSLDEDQIAANLVKNGPLAVAINAVYMQTYIGGVSCPY--ICSR-RLDHGVVLVGYG 703
            SA +GVT +SDLT  EF RT+L       +P      P       N++P +FDWREKGAV  VK+QG CGSCW+FSTTG +E   F  TGKL+SLSEQQLVDCD           D GCNGGL ++A+E  +K GGLM E++YPY    +   C      +A  + +   ++ DE ++AA L  N  ++V +NA+ +Q Y  G+S P+   CS+  LDH V+LVGYG
Sbjct:   60 SAIYGVTPYSDLTTDEFARTHL--TASWVVPSSRSNTPTSLGKEVNNIPKNFDWREKGAVTEVKNQGMCGSCWAFSTTGNVESQWFRKTGKLLSLSEQQLVDCD---------GLDDGCNGGLPSNAYESIIKMGGLMLEDNYPYDA--KNEKCHLKTDGVAVYINSSVNLTQDETELAAWLYHNSTISVGMNALLLQFYQHGISHPWWIFCSKYLLDHAVLLVGYG 273          
BLAST of FC875476 vs. ExPASy Swiss-Prot
Match: GCP1_ARATH (Germination-specific cysteine protease 1 OS=Arabidopsis thaliana GN=GCP1 PE=2 SV=2)

HSP 1 Score: 176.407 bits (446), Expect = 1.323e-43
Identity = 104/245 (42.45%), Postives = 143/245 (58.37%), Query Frame = 2
Query:    2 NLRRAARRQKLDPSATH--GVTQFSDLTPAEFRRTYLGLR----RKLRLPKDADQAPILPTN--DLPADFDWREKGAVGPVKDQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHECDPEEPGSCDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGTDRGHACKFDKSKIAASVANFSVVSLDEDQIAANLVKNGPLAVAINA--VYMQTYIGGVSCPYICSRRLDHGVVLVGYGS 706
            NLR      + + +AT+  G+T+F+DLT  E+R+ YLG R    R++   K+ +Q      N  ++P   DWR+KGAV P+KDQG+CGSCW+FSTT A+EG N + TG+L+SLSEQ+LVDCD         S + GCNGGLM+ AF++ +K GGL  E+DYPY G   G    F K+    S+  +  V   ++      +   P++VAI A     Q Y  G+     C   LDH VV VGYGS
Sbjct:   80 NLRFIDLHNEDNKNATYKLGLTKFTDLTNDEYRKLYLGARTEPARRIAKAKNVNQKYSAAVNGKEVPETVDWRQKGAVNPIKDQGTCGSCWAFSTTAAVEGINKIVTGELISLSEQELVDCDK--------SYNQGCNGGLMDYAFQFIMKNGGLNTEKDYPYRGFG-GKCNSFLKNSRVVSIDGYEDVPTKDETALKKAISYQPVSVAIEAGGRIFQHYQSGIFTG-SCGTNLDHAVVAVGYGS 314          
BLAST of FC875476 vs. ExPASy Swiss-Prot
Match: CYSP_TRYBB (Cysteine proteinase OS=Trypanosoma brucei brucei PE=1 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 1.323e-43
Identity = 106/239 (44.35%), Postives = 139/239 (58.16%), Query Frame = 2
Query:    2 NLRRAARRQKLDPSATHGVTQFSDLTPAEFRRTYL-GLRRKLRLPKDADQAPILPTNDLPADFDWREKGAVGPVKDQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHECDPEEPGSCDSGCNGGLMNSAFEYTLKA--GGLMREEDYPY-TGTDRGHACKFDKSKIAASVANFSVVSLDEDQIAANLVKNGPLAVAINAVYMQTYIGGV--SCPYICSRRLDHGVVLVGY 700
            N+ +A  +   +P AT GVT FSD+T  EFR  Y  G        K   +   + T   PA  DWREKGAV PVK QG CGSCW+FST G +EG   +A   LVSLSEQ LV CD         + DSGCNGGLM++AF + + +  G +  E  YPY +G      C+ +  +I A++ +   +  DED IAA L +NGPLA+A++A     Y GG+  SC    S++LDHGV+LVGY
Sbjct:   68 NMEQAKIQAAANPYATFGVTPFSDMTREEFRARYRNGASYFAAAQKRLRKTVNVTTGRAPAAVDWREKGAVTPVKVQGQCGSCWAFSTIGNIEGQWQVAGNPLVSLSEQMLVSCD---------TIDSGCNGGLMDNAFNWIVNSNGGNVFTEASYPYVSGNGEQPQCQMNGHEIGAAITDHVDLPQDEDAIAAYLAENGPLAIAVDAESFMDYNGGILTSC---TSKQLDHGVLLVGY 294          
BLAST of FC875476 vs. ExPASy Swiss-Prot
Match: CATF_HUMAN (Cathepsin F OS=Homo sapiens GN=CTSF PE=1 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 1.911e-42
Identity = 108/240 (45.00%), Postives = 139/240 (57.92%), Query Frame = 2
Query:    2 NLRRAARRQKLDP-SATHGVTQFSDLTPAEFRRTYLGLRRKLRLPKDADQAPILPTNDL-PADFDWREKGAVGPVKDQGSCGSCWSFSTTGALEGANFLATGKLVSLSEQQLVDCDHECDPEEPGSCDSGCNGGLMNSAFEYTLKAGGLMREEDYPYTGTDRGHACKFDKSKIAASVANFSVVSLDEDQIAANLVKNGPLAVAINAVYMQTYIGGVSCPY--ICSRRL-DHGVVLVGYGS 706
            N+ RA + Q LD  +A +GVT+FSDLT  EFR  YL    +        QA  +   DL P ++DWR KGAV  VKDQG CGSCW+FS TG +EG  FL  G L+SLSEQ+L+DCD           D  C GGL ++A+      GGL  E+DY Y G     +C F   K    + +   +S +E ++AA L K GP++VAINA  MQ Y  G+S P   +CS  L DH V+LVGYG+
Sbjct:  214 NMVRAQKIQALDRGTAQYGVTKFSDLTEEEFRTIYLNTLLRKEPGNKMKQAKSV--GDLAPPEWDWRSKGAVTKVKDQGMCGSCWAFSVTGNVEGQWFLNQGTLLSLSEQELLDCD---------KMDKACMGGLPSNAYSAIKNLGGLETEDDYSYQG--HMQSCNFSAEKAKVYINDSVELSQNEQKLAAWLAKRGPISVAINAFGMQFYRHGISRPLRPLCSPWLIDHAVLLVGYGN 440          
The following BLAST results are available for this feature:
BLAST of FC875476 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 163
Match NameE-valueIdentityDescription
A494_ARATH2.069e-11382.63Probable cysteine proteinase A494 OS=Arabidopsis t... [more]
RD19A_ARATH6.020e-11382.63Cysteine proteinase RD19a OS=Arabidopsis thaliana ... [more]
CYSP_PEA4.781e-10274.47Cysteine proteinase 15A OS=Pisum sativum PE=2 SV=1[more]
CYSP1_MAIZE6.904e-10173.86Cysteine proteinase 1 OS=Zea mays GN=CCP1 PE=2 SV=... [more]
CYSP1_DICDI1.560e-5247.30Cysteine proteinase 1 OS=Dictyostelium discoideum ... [more]
CYSP2_DICDI3.721e-4645.45Cysteine proteinase 2 OS=Dictyostelium discoideum ... [more]
CATL_SCHMA7.017e-4545.37Cathepsin L OS=Schistosoma mansoni GN=CL1 PE=2 SV=... [more]
GCP1_ARATH1.323e-4342.45Germination-specific cysteine protease 1 OS=Arabid... [more]
CYSP_TRYBB1.323e-4344.35Cysteine proteinase OS=Trypanosoma brucei brucei P... [more]
CATF_HUMAN1.911e-4245.00Cathepsin F OS=Homo sapiens GN=CTSF PE=1 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31404D03EF CTVClemen1 Citrus clementina cDNA clone C31404D03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875476 ID=FC875476|Name=FC875476|organism=Citrus clementina|type=EST|length=711bp
CAACTTGCGACGCGCCGCGCGTCGCCAGAAGCTCGACCCGAGCGCCACCC
ACGGCGTCACTCAGTTCTCCGACTTGACTCCGGCCGAGTTCCGCCGGACG
TACCTTGGCCTCAGGAGGAAGCTGAGGCTGCCTAAGGATGCGGATCAGGC
GCCGATCTTGCCTACGAATGATTTGCCGGCGGATTTTGATTGGAGAGAGA
AGGGCGCTGTAGGCCCTGTTAAAGATCAGGGTTCATGCGGATCATGCTGG
AGTTTCAGTACAACAGGGGCCTTGGAAGGTGCTAACTTCCTGGCAACTGG
AAAGCTTGTGAGCCTCAGTGAGCAACAGCTTGTGGATTGCGATCATGAGT
GTGATCCTGAGGAACCAGGTTCTTGTGATTCTGGATGCAATGGTGGGCTT
ATGAACAGTGCTTTTGAGTACACACTCAAGGCTGGTGGGCTTATGCGGGA
GGAAGACTATCCTTACACCGGCACTGATCGTGGCCACGCCTGCAAATTCG
ATAAGAGTAAGATTGCTGCCTCAGTGGCCAACTTCAGTGTTGTCTCCCTT
GATGAGGATCAAATTGCTGCCAATCTTGTGAAAAATGGTCCCCTTGCAGT
GGCCATCAATGCCGTGTACATGCAGACATACATTGGGGGAGTTTCCTGCC
CATACATATGCTCGAGGCGATTGGACCATGGAGTGGTGCTCGTGGGATAC
GGTTCAGCTGG
back to top