FC875481

Overview
NameFC875481
Unique NameFC875481
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length703
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10212 contig Ccv1_Contig10212:223..925. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP72_SOLLC (Heat shock cognate 70 kDa protein 2 OS=Solanum lycopersicum GN=HSC-2 PE=2 SV=1)

HSP 1 Score: 431.024 bits (1107), Expect = 2.932e-120
Identity = 217/234 (92.74%), Postives = 226/234 (96.58%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYVGFTD+ERLIGDAAKNQVAMNP NTVFDAKRLIGRRFSDASVQ DMKLWPFKVI GP DKPMI VNYKGEEKQF+AEEISSMVLIKM+EIAEA+LG+T+KNAVVTVPAY NDSQRQATKDAGVI+GLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRK + DI+GNPRALRRLRTA
Sbjct:   39 RTTPSYVGFTDSERLIGDAAKNQVAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKVIPGPGDKPMIVVNYKGEEKQFSAEEISSMVLIKMKEIAEAFLGTTVKNAVVTVPAYSNDSQRQATKDAGVISGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKNKKDITGNPRALRRLRTA 272          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP71_ARATH (Heat shock cognate 70 kDa protein 1 OS=Arabidopsis thaliana GN=HSC70-1 PE=1 SV=3)

HSP 1 Score: 431.024 bits (1107), Expect = 2.932e-120
Identity = 218/234 (93.16%), Postives = 225/234 (96.15%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTD+ERLIGDAAKNQVAMNP NTVFDAKRLIGRRFSD+SVQ DMKLWPFK+ AGPADKPMI V YKGEEK+FAAEEISSMVLIKMREIAEAYLG TIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRK + DI+GNPRALRRLRT+
Sbjct:   39 RTTPSYVAFTDSERLIGDAAKNQVAMNPVNTVFDAKRLIGRRFSDSSVQSDMKLWPFKIQAGPADKPMIYVEYKGEEKEFAAEEISSMVLIKMREIAEAYLGVTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKSKKDITGNPRALRRLRTS 272          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP7C_PETHY (Heat shock cognate 70 kDa protein OS=Petunia hybrida GN=HSP70 PE=2 SV=1)

HSP 1 Score: 430.254 bits (1105), Expect = 5.002e-120
Identity = 218/234 (93.16%), Postives = 223/234 (95.30%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYVGFTDTERLIGDAAKNQVAMNP NTVFDAKRLIGRRFSD SVQ D+KLWPFKVI GP DKPMI V YKGEEKQFAAEEISSMVL KM+EIAEAYLG+TIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKA+S GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRK + DISGNPRALRRLRTA
Sbjct:   39 RTTPSYVGFTDTERLIGDAAKNQVAMNPINTVFDAKRLIGRRFSDPSVQSDIKLWPFKVIPGPGDKPMIVVTYKGEEKQFAAEEISSMVLTKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKASSAGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTA 272          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP71_SOLLC (Heat shock cognate 70 kDa protein 1 OS=Solanum lycopersicum GN=HSC-I PE=2 SV=1)

HSP 1 Score: 426.787 bits (1096), Expect = 5.530e-119
Identity = 215/234 (91.88%), Postives = 223/234 (95.30%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYVGFTDTERLIGDAAKNQVA+NP NTVFDAKRLIGRRFSDASVQ DMKLWPFKVI GP DKPMI V YKGEEK+FAAEEISSMVL KM+EIAEA+LGST+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEPTAAAIAYGLDKKATS GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFV EFKRK + DI+GNPRALRRLRTA
Sbjct:   39 RTTPSYVGFTDTERLIGDAAKNQVALNPINTVFDAKRLIGRRFSDASVQEDMKLWPFKVIPGPGDKPMIVVTYKGEEKEFAAEEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEPTAAAIAYGLDKKATSAGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVHEFKRKHKKDITGNPRALRRLRTA 272          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP73_ARATH (Heat shock cognate 70 kDa protein 3 OS=Arabidopsis thaliana GN=HSC70-3 PE=1 SV=1)

HSP 1 Score: 425.246 bits (1092), Expect = 1.609e-118
Identity = 213/234 (91.03%), Postives = 226/234 (96.58%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTD+ERLIGDAAKNQVAMNP NTVFDAKRLIGRRF+D+SVQ D+KLWPF + +GPA+KPMI VNYKGE+K+F+AEEISSM+LIKMREIAEAYLG+TIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRK + DISGNPRALRRLRTA
Sbjct:   39 RTTPSYVAFTDSERLIGDAAKNQVAMNPINTVFDAKRLIGRRFTDSSVQSDIKLWPFTLKSGPAEKPMIVVNYKGEDKEFSAEEISSMILIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTA 272          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP72_ARATH (Heat shock cognate 70 kDa protein 2 OS=Arabidopsis thaliana GN=HSC70-2 PE=2 SV=2)

HSP 1 Score: 421.009 bits (1081), Expect = 3.035e-117
Identity = 212/234 (90.60%), Postives = 223/234 (95.30%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTD+ERLIGDAAKNQVAMNP NTVFDAKRLIGRRFSDASVQ D +LWPF +I+G A+KPMI V YKGEEKQFAAEEISSMVLIKMREIAEA+LG+T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNV+RIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRK + DI+G PRALRRLRTA
Sbjct:   39 RTTPSYVAFTDSERLIGDAAKNQVAMNPVNTVFDAKRLIGRRFSDASVQSDRQLWPFTIISGTAEKPMIVVEYKGEEKQFAAEEISSMVLIKMREIAEAFLGTTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKNKQDITGQPRALRRLRTA 272          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP70_MAIZE (Heat shock 70 kDa protein OS=Zea mays GN=HSP70 PE=3 SV=2)

HSP 1 Score: 414.461 bits (1064), Expect = 2.840e-115
Identity = 214/234 (91.45%), Postives = 219/234 (93.59%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFS  +VQ  MKLWP + + G  DKPMI  NYKGEEKQFAAEEISSMVLIKM+EIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATS GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRK + DISGNPRALRRLRTA
Sbjct:   38 RTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSSPAVQSSMKLWPSRHL-GLGDKPMIVFNYKGEEKQFAAEEISSMVLIKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSSGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKNKKDISGNPRALRRLRTA 270          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP7E_SPIOL (Chloroplast envelope membrane 70 kDa heat shock-related protein OS=Spinacia oleracea GN=SCE70 PE=1 SV=3)

HSP 1 Score: 411.764 bits (1057), Expect = 1.841e-114
Identity = 209/234 (89.32%), Postives = 219/234 (93.59%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTD+ERLIGDAAKNQVAMNP NTVFDAKRLIGRRFSDASVQ DMK  PFKV++GP +KPMIGVNYKGEEKQFAAEEISSMVL KM+EIAEAYLGST+KNAVVTVPAYFNDSQRQATKDAGVI+GLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNH +QEFKRK + DI   P  +RRLRTA
Sbjct:   39 RTTPSYVAFTDSERLIGDAAKNQVAMNPINTVFDAKRLIGRRFSDASVQADMKHRPFKVVSGPGEKPMIGVNYKGEEKQFAAEEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHSLQEFKRKNKKDIMETPGHIRRLRTA 272          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP70_SOYBN (Heat shock 70 kDa protein OS=Glycine max GN=HSP70 PE=3 SV=1)

HSP 1 Score: 408.683 bits (1049), Expect = 1.558e-113
Identity = 204/234 (87.18%), Postives = 217/234 (92.74%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTDTERLIGDAAKNQVAMNP NTVFDAKRLIGRRFSD+SVQ DMKLWPFKV   P DKPMI VNYKGEEK+F+AEEISSMVL+KMRE+AEA+LG  +KNAVVTVPAYFNDSQRQATKDAG I+GLNV+RIINEPTAAAIAYGLDKKA+  GE+NVLIFDLGGGTFDVS+LTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFV EFKRK + DISGN RALRRLRTA
Sbjct:   38 RTTPSYVAFTDTERLIGDAAKNQVAMNPQNTVFDAKRLIGRRFSDSSVQNDMKLWPFKVGGSPCDKPMIVVNYKGEEKKFSAEEISSMVLVKMREVAEAFLGHAVKNAVVTVPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKASRKGEQNVLIFDLGGGTFDVSILTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVSEFKRKNKKDISGNARALRRLRTA 271          
BLAST of FC875481 vs. ExPASy Swiss-Prot
Match: HSP72_USTMA (Heat shock 70 kDa protein 2 OS=Ustilago maydis GN=UMS2 PE=3 SV=2)

HSP 1 Score: 375.555 bits (963), Expect = 1.462e-103
Identity = 192/234 (82.05%), Postives = 208/234 (88.89%), Query Frame = 1
Query:    1 RTTPSYVGFTDTERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKKQXDISGNPRALRRLRTA 702
            RTTPSYV FTD+ERLIGDAAKNQVAMNP NTVFDAKRLIGR+F DA VQ DMK WPF+V +    KP I + YKGE+K F  EEISSMVL+KMRE AEAYLG T+K+AVVTVPAYFNDSQRQATKDAG+I+GLNVMRIINEPTAAAIAYGLDKK  + GEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNR+VNHFVQEFKRK + D++ N RALRRLRTA
Sbjct:   34 RTTPSYVAFTDSERLIGDAAKNQVAMNPHNTVFDAKRLIGRKFDDAEVQSDMKHWPFEVTS-VGGKPQIRIEYKGEKKTFTPEEISSMVLLKMRETAEAYLGGTVKDAVVTVPAYFNDSQRQATKDAGIISGLNVMRIINEPTAAAIAYGLDKK--TEGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVNHFVQEFKRKNKKDLTTNARALRRLRTA 264          
The following BLAST results are available for this feature:
BLAST of FC875481 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
HSP72_SOLLC2.932e-12092.74Heat shock cognate 70 kDa protein 2 OS=Solanum lyc... [more]
HSP71_ARATH2.932e-12093.16Heat shock cognate 70 kDa protein 1 OS=Arabidopsis... [more]
HSP7C_PETHY5.002e-12093.16Heat shock cognate 70 kDa protein OS=Petunia hybri... [more]
HSP71_SOLLC5.530e-11991.88Heat shock cognate 70 kDa protein 1 OS=Solanum lyc... [more]
HSP73_ARATH1.609e-11891.03Heat shock cognate 70 kDa protein 3 OS=Arabidopsis... [more]
HSP72_ARATH3.035e-11790.60Heat shock cognate 70 kDa protein 2 OS=Arabidopsis... [more]
HSP70_MAIZE2.840e-11591.45Heat shock 70 kDa protein OS=Zea mays GN=HSP70 PE=... [more]
HSP7E_SPIOL1.841e-11489.32Chloroplast envelope membrane 70 kDa heat shock-re... [more]
HSP70_SOYBN1.558e-11387.18Heat shock 70 kDa protein OS=Glycine max GN=HSP70 ... [more]
HSP72_USTMA1.462e-10382.05Heat shock 70 kDa protein 2 OS=Ustilago maydis GN=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31404D09EF CTVClemen1 Citrus clementina cDNA clone C31404D09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875481 ID=FC875481|Name=FC875481|organism=Citrus clementina|type=EST|length=703bp
AGGACGACGCCGTCTTATGTGGGGTTCACCGACACGGAGCGTTTGATCGG
GGACGCTGCTAAGAACCAGGTCGCCATGAACCCCACGAACACCGTCTTTG
ATGCAAAGAGGTTGATTGGTAGGAGATTCAGCGATGCATCAGTCCAAGGA
GATATGAAGCTATGGCCATTTAAGGTGATTGCTGGACCAGCTGACAAGCC
CATGATTGGTGTTAACTACAAGGGCGAAGAGAAGCAGTTTGCTGCTGAGG
AAATCTCGTCTATGGTGCTCATCAAGATGCGTGAGATTGCCGAGGCTTAC
CTTGGCTCAACTATTAAGAATGCAGTCGTTACTGTCCCTGCTTACTTCAA
TGACTCACAGAGGCAGGCCACCAAGGATGCTGGTGTCATTGCTGGGCTTA
ATGTGATGCGTATCATCAATGAGCCCACTGCTGCTGCCATTGCTTATGGC
CTTGACAAGAAGGCTACTAGTGTGGGTGAGAAGAATGTGTTGATCTTTGA
TTTGGGTGGTGGTACTTTTGATGTGTCGTTGCTCACTATTGAGGAGGGAA
TCTTTGAAGTGAAGGCTACTGCTGGAGACACTCATCTTGGTGGTGAGGAT
TTTGATAACAGAATGGTGAATCATTTTGTTCAGGAGTTTAAGAGGAAGAA
ACAGAANGATATTAGTGGCAACCCTAGAGCTCTTAGGAGATTGAGGACTG
CTT
back to top