FC875588

Overview
NameFC875588
Unique NameFC875588
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length635
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig462 contig Ccv1_Contig462:20..658. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875588 vs. ExPASy Swiss-Prot
Match: LEA5_CITSI (Late embryogenesis abundant protein Lea5 OS=Citrus sinensis GN=LEA5 PE=2 SV=1)

HSP 1 Score: 192.971 bits (489), Expect = 1.104e-48
Identity = 97/97 (100.00%), Postives = 97/97 (100.00%), Query Frame = 2
Query:  149 MARSLFKAKLLLAPVADGISLSISRRGYAAAAPLGTISRTGIMEKNDLRPAVREDSGASSAWAPDPITGYYRPENRAVEIDPAELREMLLNHKVRAH 439
            MARSLFKAKLLLAPVADGISLSISRRGYAAAAPLGTISRTGIMEKNDLRPAVREDSGASSAWAPDPITGYYRPENRAVEIDPAELREMLLNHKVRAH
Sbjct:    1 MARSLFKAKLLLAPVADGISLSISRRGYAAAAPLGTISRTGIMEKNDLRPAVREDSGASSAWAPDPITGYYRPENRAVEIDPAELREMLLNHKVRAH 97          
BLAST of FC875588 vs. ExPASy Swiss-Prot
Match: LEA5D_GOSHI (Late embryogenesis abundant protein Lea5-D OS=Gossypium hirsutum GN=LEA5-D PE=2 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 1.775e-22
Identity = 58/104 (55.77%), Postives = 71/104 (68.27%), Query Frame = 2
Query:  149 MARSLFKAKLLLAPVADGISLSISRRGYAAAAPLG---TISRTGIMEKNDLRPAVREDSGA-----SSAWAPDPITGYYRPENRAVEIDPAELREMLLNHKVRA 436
            MARS+   KLL A + DG+ +SISRRGY+ A P     +  R G M K + R A++E S +     SSAWAPDP+TGYYRPEN   EID AELREMLLNH+VR+
Sbjct:    1 MARSVSSFKLLGASIFDGLYVSISRRGYSGAPPAAVTASFGRPGAMGKVERRDAMKESSSSETRAYSSAWAPDPVTGYYRPENCGAEIDAAELREMLLNHRVRS 104          
BLAST of FC875588 vs. ExPASy Swiss-Prot
Match: LEA5A_GOSHI (Late embryogenesis abundant protein Lea5-A OS=Gossypium hirsutum GN=LEA5-A PE=2 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 1.272e-20
Identity = 55/104 (52.88%), Postives = 69/104 (66.35%), Query Frame = 2
Query:  149 MARSLFKAKLLLAPVADGISLSISRRGYAAAAPLG---TISRTGIMEKNDLRPAVREDSGA-----SSAWAPDPITGYYRPENRAVEIDPAELREMLLNHKVRA 436
            MARS+   K L A V D + +SISRRGY+ A P     +  R G M K + R A++E S +     SSAWAPDP+TGYYRPEN   EID A+LREM+LNH+VR+
Sbjct:    1 MARSVSSFKFLGASVFDALYVSISRRGYSGAPPAAVTASFGRPGAMGKVERRYAMKESSSSETRAYSSAWAPDPVTGYYRPENCGAEIDAADLREMMLNHRVRS 104          
BLAST of FC875588 vs. ExPASy Swiss-Prot
Match: ARG2_PHAAU (Indole-3-acetic acid-induced protein ARG2 OS=Phaseolus aureus GN=ARG2 PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 6.997e-11
Identity = 42/97 (43.30%), Postives = 56/97 (57.73%), Query Frame = 2
Query:  149 MARSLFKAKLLLAPVADGISLSISRRGYAAAAPLG-TISRTGIMEKNDLRPAVREDS---GASSAWAPDPITGYYRPENRAVEIDPAELREMLLNHK 427
            MARS    K+L A VADG S + +R G+AAAA    + +R G     ++ P   E+    G   +W PDP+TGYYRPEN   EID A++R  +L  K
Sbjct:    1 MARSFTNVKVLSALVADGFSNTTTRHGFAAAAAATQSATRGGASIGGNMVPKSGEEKVRGGEKVSWVPDPVTGYYRPEN-TNEIDVADMRATVLGKK 96          
The following BLAST results are available for this feature:
BLAST of FC875588 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
LEA5_CITSI1.104e-48100.00Late embryogenesis abundant protein Lea5 OS=Citrus... [more]
LEA5D_GOSHI1.775e-2255.77Late embryogenesis abundant protein Lea5-D OS=Goss... [more]
LEA5A_GOSHI1.272e-2052.88Late embryogenesis abundant protein Lea5-A OS=Goss... [more]
ARG2_PHAAU6.997e-1143.30Indole-3-acetic acid-induced protein ARG2 OS=Phase... [more]
back to top
Properties
Property NameValue
Genbank descriptionC31405F02EF CTVClemen1 Citrus clementina cDNA clone C31405F02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875588 ID=FC875588|Name=FC875588|organism=Citrus clementina|type=EST|length=635bp
GAAAAGCACAGCACAAAGAGAGCGAGCCGCTAGCTTTTGCCTATAGCTAC
TGCAGGAGCAGAATCTTTCTTCTTCTGTAGTAGCACTGTACAGAAACATC
CCAGCTAGCTATCTTCATATCTATTAAGTTCTATAAGTAAATAAAACAAT
GGCCCGCTCTCTCTTCAAAGCTAAGCTTCTTCTTGCTCCTGTTGCTGATG
GCATCTCGCTCTCCATTAGCAGGAGAGGATATGCTGCAGCAGCACCCTTG
GGGACCATATCTCGGACTGGTATCATGGAGAAAAATGATTTGAGGCCTGC
GGTGAGAGAGGATTCTGGGGCCTCTTCTGCCTGGGCCCCAGATCCCATCA
CTGGGTACTACAGGCCGGAGAATCGGGCGGTCGAGATTGATCCAGCAGAG
CTTCGAGAGATGCTGTTGAACCACAAAGTCAGGGCACACTAGGGAGTGGC
CGCGCATGGCAGATCCTTTGCTGTTAGCGGTGCTTTAACTTTTTAAGTGA
TGTTGTTACAGTAGCAATTTTGACTCACTCTAAGTCTTTGCTGTTGTATT
GATATCAACTGTTATTGACAACTTTTAATAGTGCATTTCCATGATTTTGT
CTATTAACTTGTCAATAAAAGTAAAGAATTCCTGT
back to top