FC875589

Overview
NameFC875589
Unique NameFC875589
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length691
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig11885 contig Ccv1_Contig11885:742..1432. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875589 vs. ExPASy Swiss-Prot
Match: SEN1_YEAST (Helicase SEN1 OS=Saccharomyces cerevisiae GN=SEN1 PE=1 SV=2)

HSP 1 Score: 128.257 bits (321), Expect = 3.931e-29
Identity = 63/159 (39.62%), Postives = 101/159 (63.52%), Query Frame = 1
Query:   13 LRPYIFFDVIHGRESHRGGSVSYQNVDEAKFGVCLYEHLQKTLKSMGLGKVTVGIITPYKLQLKCLQHEFRNVLNSEEGKDLYINTVDAFQGQERDVIIMSCVRASN--HGVGFVADIRRVNVALTRARRALWVMGNAGALTQSDDWAALIADSKARNC 483
            L PY FFD+I GR+     ++SY N++E +  + L ++L +   +       +GII+PY+ Q++ ++ EF         K +  NT+D FQGQE+++I++SCVRA +    VGF+ D RR+NVALTRA+ ++WV+G+  +L +S  W  LI D+K R+C
Sbjct: 1694 LAPYKFFDIISGRQEQNAKTMSYTNMEEIRVAIELVDYLFRKFDNKIDFTGKIGIISPYREQMQKMRKEFARYFGGMINKSIDFNTIDGFQGQEKEIILISCVRADDTKSSVGFLKDFRRMNVALTRAKTSIWVLGHQRSLAKSKLWRDLIEDAKDRSC 1852          
BLAST of FC875589 vs. ExPASy Swiss-Prot
Match: YGSA_SCHPO (Uncharacterized ATP-dependent helicase C29A10.10c OS=Schizosaccharomyces pombe GN=SPBC29A10.10c PE=2 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 5.134e-29
Identity = 75/169 (44.38%), Postives = 113/169 (66.86%), Query Frame = 1
Query:    1 KDPVLRPYIFFDVIHGRESHRGGSVSYQNVDEAKFGVCLYEHLQKTLKSMGL-GKVTVGIITPYKLQLKCLQHEFRNVLNSEEGKDLYINTVDAFQGQERDVIIMSCVRAS-NHGVGFVADIRRVNVALTRARRALWVMGNAGALTQSDDWAALIADSKARNCYMDMDS 501
            +DP L  Y FF+V HG E+    S S  NV+EA F + LYE L +   ++   GK+  G++TPY+ Q++ L+ +F+    S   K L I+TVD FQGQE+D+II SCVR+S + G+GF+ D+RR+NVALTRA+ +L+++GN+  L Q D + +LI D+K R  + D+ +
Sbjct: 1618 EDPQLGIYRFFNV-HGTEAF-SNSKSLYNVEEASFILLLYERLIQCYLNIDFEGKI--GVVTPYRSQVQQLRSQFQRKYGSIIFKHLDIHTVDGFQGQEKDIIIFSCVRSSMSGGIGFLQDLRRLNVALTRAKSSLYIVGNSKPLMQEDIFYSLIEDAKTRGVWRDLSA 1782          
BLAST of FC875589 vs. ExPASy Swiss-Prot
Match: SEN1_SCHPO (Helicase sen1 OS=Schizosaccharomyces pombe GN=sen1 PE=1 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 6.079e-22
Identity = 63/163 (38.65%), Postives = 92/163 (56.44%), Query Frame = 1
Query:    4 DPVLRPYIFFDVIHGRESHRGGSVSYQNVDEAKFGVCLYEHLQKTLKSMGLGKVTVGIITPYKLQLKCLQHEFRNVLNSEEGKDLY----INTVDAFQGQERDVIIMSCVRA-SNHGVGFVADIRRVNVALTRARRALWVMGNAGALTQSDDWAALIADSKAR 477
            +P    Y  FDV  G+E     ++S  N++E ++ V + + L      +      +G+ITPY+ QL    HE R     + GK       I TVD FQGQE+D+I  SCV++ S HG+GF+ D RR+NVALTRAR +L ++GN   L   D W +L+ D+ +R
Sbjct: 1481 NPKFTQYRLFDV-RGKE-RTSNTMSTYNLEEVEYLVNMVDELLNKFPDVNFTG-RIGVITPYRSQL----HELRRAFKVKYGKSFMSTIDIQTVDGFQGQEKDIIFFSCVKSYSKHGIGFLRDFRRLNVALTRARSSLLIIGNMETLKTDDLWGSLVDDALSR 1636          
BLAST of FC875589 vs. ExPASy Swiss-Prot
Match: Y4399_DICDI (Probable helicase DDB_G0274399 OS=Dictyostelium discoideum GN=DDB_G0274399 PE=3 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 1.769e-21
Identity = 60/155 (38.71%), Postives = 89/155 (57.42%), Query Frame = 1
Query:    4 DPVLRPYIFFDVIHGRESHRGGSVSYQNVDEAKFGVCLYEHLQKTLKSMGLGKVTVGIITPYKLQLKCLQHEFRNVLNSEEGKDLYINTVDAFQGQERDVIIMSCVRA---SNHGVGFVADIRRVNVALTRARRALWVMGNAGALTQSDDWAALI 459
            +P   P +F+D+    E+  GG  S  N  E K  + L++   K           +GII+PY+ Q+  L+  F+N         + I+TVD FQG+ER++II SCVRA      G+GF++D+RR+NVALTR R +L ++GN  AL+ + DW  LI
Sbjct:  691 NPFFGPLVFYDLSWSTETKPGGG-SVFNEHECKMAMYLFQLFTKVYPDEDFAS-RIGIISPYRQQVLALREIFKNY------PGISIDTVDGFQGREREIIIFSCVRAPVEEGAGIGFLSDVRRMNVALTRPRSSLLILGNTKALSINKDWNELI 837          
BLAST of FC875589 vs. ExPASy Swiss-Prot
Match: RENT1_DICDI (Regulator of nonsense transcripts 1 OS=Dictyostelium discoideum GN=upf1 PE=3 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 5.690e-20
Identity = 78/217 (35.94%), Postives = 114/217 (52.53%), Query Frame = 1
Query:    1 KDPVLRPYIFFDVIHGRESHRGGSVSYQNVDEAKFGVCLYEHLQKTLKSMGLGKVTVGIITPYKLQLKCLQHEFRNV--LNSEEGKDLYINTVDAFQGQERDVIIMSCVRASNH-GVGFVADIRRVNVALTRARRALWVMGNAGALTQSDDWAALIADSKARNCYMDMDSLP--KEFSVALAAKAPGYGPLQGKIPHNARGLRSAGQRHRSFDMNME 636
            KDP+     FF    G E       S+ N  EA   +C  E +      +G     +GIITPY+ Q   +    +    LN E  K + + +VD+FQG+E+D II+SCVR++++ G+GF+ D RR+NVALTRAR  L ++GNA  L++   W +LI+  K +N  ++  SL   K+  V L      YG  QGK+P         GQ   SF+ + E
Sbjct:  812 KDPM-----FFFNCTGSEEISSSGTSFINTTEAS--IC--EKIVTKFLELGSLPGQIGIITPYEGQRAYITSHMQKSGKLNLELYKSIEVASVDSFQGREKDYIILSCVRSNDYQGIGFLQDPRRLNVALTRARFGLIILGNAKVLSKDPLWNSLISHFKNKNVLVE-GSLANLKQSPVILQKPKKLYG--QGKLP-------IPGQNSNSFNYDRE 1009          
BLAST of FC875589 vs. ExPASy Swiss-Prot
Match: RENT1_MOUSE (Regulator of nonsense transcripts 1 OS=Mus musculus GN=Upf1 PE=1 SV=2)

HSP 1 Score: 95.5153 bits (236), Expect = 2.824e-19
Identity = 61/159 (38.36%), Postives = 91/159 (57.23%), Query Frame = 1
Query:   25 IFFDVIHGRESHRGGSVSYQNVDEAKFGVCLYEHLQKTLKSMGLGKVTVGIITPYKLQLKCLQH--EFRNVLNSEEGKDLYINTVDAFQGQERDVIIMSCVRASNH-GVGFVADIRRVNVALTRARRALWVMGNAGALTQSDDWAALIADSKARNCYMD 492
            +FF V  G+E       SY N  EA       E +   L   G     +GIITPY+ Q   L    +F   L+++  +++ I +VDAFQG+E+D II+SCVRA+ H G+GF+ D RR+NVALTRAR  + ++GN  AL++   W  L++  K +   ++
Sbjct:  752 MFFYVTQGQEEIASSGTSYLNRTEA----ANVEKITTKLLKAGAKPDQIGIITPYEGQRSYLVQYMQFSGSLHTKLYQEVEIASVDAFQGREKDFIILSCVRANEHQGIGFLNDPRRLNVALTRARYGVIIVGNPKALSKQPLWNHLLSYYKEQKALVE 906          
BLAST of FC875589 vs. ExPASy Swiss-Prot
Match: SETX_MOUSE (Probable helicase senataxin OS=Mus musculus GN=Setx PE=2 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 4.817e-19
Identity = 55/156 (35.26%), Postives = 94/156 (60.26%), Query Frame = 1
Query:   16 RPYIFFDVIHGRESHRGGSVSYQNVDEAKFGVCLYEHLQKTLKSMGLGKVTVGIITPYKLQLKCLQHEFRNVLNSEEGKDLYINTVDAFQGQERDVIIMSCVRAS--NHGVGFVADIRRVNVALTRARRALWVMGNAGALTQSDDWAALIADSKAR 477
            +PY+ FDV  G  S R  + SY NV E K  + + + +++  K +    +  GIIT YK Q   +Q +     + +   +  ++TVDAFQG+++D II++CVRAS     +GF+A ++R+NV +TRA+ +L+++G+   L ++  W  LI D++ R
Sbjct: 2271 QPYLVFDV--GDGSERRDNDSYINVQEIKLVMEIIKLIKEKRKDISFRNI--GIITHYKAQKTMIQKDLEKEFDKKGPAE--VDTVDAFQGRQKDCIIVTCVRASAVQGSIGFLASLQRLNVTITRAKYSLFILGHLRTLMENQHWYELIQDAQKR 2420          
BLAST of FC875589 vs. ExPASy Swiss-Prot
Match: RENT1_HUMAN (Regulator of nonsense transcripts 1 OS=Homo sapiens GN=UPF1 PE=1 SV=2)

HSP 1 Score: 94.3597 bits (233), Expect = 6.291e-19
Identity = 60/148 (40.54%), Postives = 86/148 (58.11%), Query Frame = 1
Query:   25 IFFDVIHGRESHRGGSVSYQNVDEAKFGVCLYEHLQKTLKSMGLGKVTVGIITPYKLQLKCLQH--EFRNVLNSEEGKDLYINTVDAFQGQERDVIIMSCVRASNH-GVGFVADIRRVNVALTRARRALWVMGNAGALTQSDDWAALI 459
            +FF V  G+E       SY N  EA       E +   L   G     +GIITPY+ Q   L    +F   L+++  +++ I +VDAFQG+E+D II+SCVRA+ H G+GF+ D RR+NVALTRAR  + ++GN  AL++   W  L+
Sbjct:  757 MFFYVTQGQEEIASSGTSYLNRTEA----ANVEKITTKLLKAGAKPDQIGIITPYEGQRSYLVQYMQFSGSLHTKLYQEVEIASVDAFQGREKDFIILSCVRANEHQGIGFLNDPRRLNVALTRARYGVIIVGNPKALSKQPLWNHLL 900          
BLAST of FC875589 vs. ExPASy Swiss-Prot
Match: RENT1_ARATH (Regulator of nonsense transcripts 1 homolog OS=Arabidopsis thaliana GN=UPF1 PE=1 SV=2)

HSP 1 Score: 92.8189 bits (229), Expect = 1.830e-18
Identity = 60/165 (36.36%), Postives = 90/165 (54.55%), Query Frame = 1
Query:    7 PVLRPYIFFDVIHGRESHRGGSVSYQNVDEAKFGVCLYEHLQKTLKSMGLGKVTVGIITPYKLQLKCL-QHEFRN-VLNSEEGKDLYINTVDAFQGQERDVIIMSCVRASNH-GVGFVADIRRVNVALTRARRALWVMGNAGALTQSDDWAALIADSKARNCYMD 492
            PV    +FF V  G+E       SY N  EA       E L       G+    +G+ITPY+ Q   +  +  RN  L  +  K++ + +VD+FQG+E+D II+SCVR++ H G+GF+ D RR+NVALTRAR  + ++GN   L++   W  L+   K   C ++
Sbjct:  760 PVPNRPMFFYVQLGQEEISASGTSYLNRTEA----ANVEKLVTAFLKSGVVPSQIGVITPYEGQRAYIVNYMARNGSLRQQLYKEIEVASVDSFQGREKDYIILSCVRSNEHQGIGFLNDPRRLNVALTRARYGIVILGNPKVLSKQPLWNGLLTHYKEHECLVE 920          
BLAST of FC875589 vs. ExPASy Swiss-Prot
Match: SETX_HUMAN (Probable helicase senataxin OS=Homo sapiens GN=SETX PE=1 SV=3)

HSP 1 Score: 91.6633 bits (226), Expect = 4.078e-18
Identity = 53/156 (33.97%), Postives = 94/156 (60.26%), Query Frame = 1
Query:   16 RPYIFFDVIHGRESHRGGSVSYQNVDEAKFGVCLYEHLQKTLKSMGLGKVTVGIITPYKLQLKCLQHEFRNVLNSEEGKDLYINTVDAFQGQERDVIIMSCVRASN--HGVGFVADIRRVNVALTRARRALWVMGNAGALTQSDDWAALIADSKAR 477
            +PY+ FDV  G  S R  + SY NV E K  + + + ++   K +    +  GIIT YK Q   +Q +     + +   +  ++TVDAFQG+++D +I++CVRA++    +GF+A ++R+NV +TRA+ +L+++G+   L ++  W  LI D++ R
Sbjct: 2295 QPYLVFDV--GDGSERRDNDSYINVQEIKLVMEIIKLIKDKRKDVSFRNI--GIITHYKAQKTMIQKDLDKEFDRKGPAE--VDTVDAFQGRQKDCVIVTCVRANSIQGSIGFLASLQRLNVTITRAKYSLFILGHLRTLMENQHWNQLIQDAQKR 2444          
The following BLAST results are available for this feature:
BLAST of FC875589 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 30
Match NameE-valueIdentityDescription
SEN1_YEAST3.931e-2939.62Helicase SEN1 OS=Saccharomyces cerevisiae GN=SEN1 ... [more]
YGSA_SCHPO5.134e-2944.38Uncharacterized ATP-dependent helicase C29A10.10c ... [more]
SEN1_SCHPO6.079e-2238.65Helicase sen1 OS=Schizosaccharomyces pombe GN=sen1... [more]
Y4399_DICDI1.769e-2138.71Probable helicase DDB_G0274399 OS=Dictyostelium di... [more]
RENT1_DICDI5.690e-2035.94Regulator of nonsense transcripts 1 OS=Dictyosteli... [more]
RENT1_MOUSE2.824e-1938.36Regulator of nonsense transcripts 1 OS=Mus musculu... [more]
SETX_MOUSE4.817e-1935.26Probable helicase senataxin OS=Mus musculus GN=Set... [more]
RENT1_HUMAN6.291e-1940.54Regulator of nonsense transcripts 1 OS=Homo sapien... [more]
RENT1_ARATH1.830e-1836.36Regulator of nonsense transcripts 1 homolog OS=Ara... [more]
SETX_HUMAN4.078e-1833.97Probable helicase senataxin OS=Homo sapiens GN=SET... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31405F03EF CTVClemen1 Citrus clementina cDNA clone C31405F03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875589 ID=FC875589|Name=FC875589|organism=Citrus clementina|type=EST|length=691bp
AAGGATCCCGTACTTAGGCCTTACATATTTTTTGATGTCATTCATGGGAG
GGAGTCCCATAGAGGTGGATCTGTTTCTTATCAAAACGTTGATGAAGCAA
AATTTGGTGTTTGCTTGTATGAGCATCTTCAGAAAACTCTGAAGTCTATG
GGTTTGGGGAAAGTCACTGTAGGCATCATTACACCATACAAGCTGCAATT
GAAATGCCTTCAACATGAGTTCCGTAATGTTTTAAATTCAGAAGAAGGAA
AAGATTTATATATTAATACTGTTGATGCTTTCCAAGGCCAAGAGCGTGAT
GTAATTATCATGTCTTGCGTGCGAGCATCAAATCATGGGGTTGGCTTTGT
TGCAGATATTCGACGTGTGAATGTTGCTCTTACTCGTGCAAGAAGAGCTC
TTTGGGTTATGGGAAATGCCGGTGCTCTCACACAATCTGATGATTGGGCT
GCATTGATTGCTGATTCGAAAGCAAGGAATTGTTATATGGACATGGACTC
CCTCCCTAAAGAGTTTTCTGTAGCACTAGCAGCAAAGGCACCAGGTTATG
GTCCATTGCAGGGCAAGATTCCCCATAATGCAAGGGGCTTGAGATCTGCT
GGGCAAAGACATCGATCATTCGATATGAATATGGAGTCCAGGTCTGGAAC
ACCATCAGAAGATGATGAGAAGGTATCTAGAAANTGGAATT
back to top