FC875591

Overview
NameFC875591
Unique NameFC875591
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length738
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10272 contig Ccv1_Contig10272:1..731. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875591 vs. ExPASy Swiss-Prot
Match: OSTC_DROME (Putative oligosaccharyltransferase complex subunit CG9662 OS=Drosophila melanogaster GN=CG9662 PE=2 SV=3)

HSP 1 Score: 111.309 bits (277), Expect = 5.545e-24
Identity = 54/141 (38.30%), Postives = 85/141 (60.28%), Query Frame = 3
Query:  177 PYSIIRPPRLRLKLPSFTLPSPMTVFALVLLTYFMVVSGFVYDVIVEPPGIGSTQDPATGSVRPVVFLPGRVNGQYIIEGLSSXXXXXXXXXXXXXXDLALDKNRAKSVKVSYASAGISSIVIAYIMSMLFIRIKIPGYLR 599
            P+ I+ PP ++++  S  +PSPM VF+++L +YF+V  G +YDVIVEPP +G+T D   G  RPV F+P RVNGQYI+EGL+S              D      +    ++   + G   I++++  + LF+R+K+P YL+
Sbjct:    9 PFHILVPPNIKVRRFSIPMPSPMAVFSVILFSYFLVTGGIIYDVIVEPPSLGATVD-EHGHSRPVAFMPYRVNGQYIMEGLASSFLFTVGGLGFIIMDQTHTPGKTNLNRLLLTAMGFIFILVSFFTTWLFMRMKLPSYLQ 148          
BLAST of FC875591 vs. ExPASy Swiss-Prot
Match: OSTC_DANRE (Oligosaccharyltransferase complex subunit ostc OS=Danio rerio GN=ostc PE=2 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 7.242e-24
Identity = 57/141 (40.43%), Postives = 88/141 (62.41%), Query Frame = 3
Query:  177 PYSIIRPPRLRLKLPSFT-LPSPMTVFALVLLTYFMVVSGFVYDVIVEPPGIGSTQDPATGSVRPVVFLPGRVNGQYIIEGLSSXXXXXXXXXXXXXXDLALDKNRAKSVKVSYASAGISSIVIAYIMSMLFIRIKIPGYL 596
            P++++  P ++LK PS+  +PS MTV+A+V+++YF++  G +YDVIVEPP +GS  D   G  RPV FL  RVNGQYI+EGL+S              D +   N  K  +      G  S+++++ M+ +F+R+K+PGYL
Sbjct:    8 PFTVLECPNVKLKKPSWLHMPSAMTVYAVVIVSYFLITGGIIYDVIVEPPSVGSMTD-EHGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIILDRSNAPNIPKLNRFLLLFIGFVSVLLSFFMARVFMRMKLPGYL 147          
BLAST of FC875591 vs. ExPASy Swiss-Prot
Match: OSTC_CHICK (Oligosaccharyltransferase complex subunit OSTC OS=Gallus gallus GN=OSTC PE=2 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 7.242e-24
Identity = 57/141 (40.43%), Postives = 87/141 (61.70%), Query Frame = 3
Query:  177 PYSIIRPPRLRLKLPSFT-LPSPMTVFALVLLTYFMVVSGFVYDVIVEPPGIGSTQDPATGSVRPVVFLPGRVNGQYIIEGLSSXXXXXXXXXXXXXXDLALDKNRAKSVKVSYASAGISSIVIAYIMSMLFIRIKIPGYL 596
            P++++  P ++LK P +  +PS MTV+ALV+++YF++  G +YDVIVEPP +GS  D   G  RPV FL  RVNGQYI+EGL+S              D +   N  K  +      G  S+++++ M+ +F+R+K+PGYL
Sbjct:    8 PFAVLECPNIKLKRPGWVHMPSAMTVYALVVVSYFLITGGIIYDVIVEPPSVGSMTD-EHGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIILDRSNAPNIPKLNRFLLLFIGFVSVLLSFFMARVFMRMKLPGYL 147          
BLAST of FC875591 vs. ExPASy Swiss-Prot
Match: OSTCA_XENLA (Oligosaccharyltransferase complex subunit ostc-A OS=Xenopus laevis GN=ostc-A PE=2 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 9.458e-24
Identity = 57/141 (40.43%), Postives = 87/141 (61.70%), Query Frame = 3
Query:  177 PYSIIRPPRLRLKLPSFT-LPSPMTVFALVLLTYFMVVSGFVYDVIVEPPGIGSTQDPATGSVRPVVFLPGRVNGQYIIEGLSSXXXXXXXXXXXXXXDLALDKNRAKSVKVSYASAGISSIVIAYIMSMLFIRIKIPGYL 596
            P++++  P L+LK PS+  +PS MTV+A+V+++YF++  G +YDVIVEPP +GS  D   G  RPV FL  RVNGQYI+EGL+S              D +   N  K  +      G   +++++ M+ +F+R+K+PGYL
Sbjct:    8 PFTVLECPNLKLKKPSWLHMPSAMTVYAMVVVSYFLITGGIIYDVIVEPPSVGSMTD-EHGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIILDRSNTPNIPKLNRFLLLFIGFVCVLLSFFMARVFMRMKLPGYL 147          
BLAST of FC875591 vs. ExPASy Swiss-Prot
Match: OSTC_XENTR (Oligosaccharyltransferase complex subunit ostc OS=Xenopus tropicalis GN=ostc PE=2 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 1.235e-23
Identity = 57/141 (40.43%), Postives = 87/141 (61.70%), Query Frame = 3
Query:  177 PYSIIRPPRLRLKLPSFT-LPSPMTVFALVLLTYFMVVSGFVYDVIVEPPGIGSTQDPATGSVRPVVFLPGRVNGQYIIEGLSSXXXXXXXXXXXXXXDLALDKNRAKSVKVSYASAGISSIVIAYIMSMLFIRIKIPGYL 596
            P++++  P L+LK PS+  +PS MTV+A+V+++YF++  G +YDVIVEPP +GS  D   G  RPV FL  RVNGQYI+EGL+S              D +   N  K  +      G   +++++ M+ +F+R+K+PGYL
Sbjct:    8 PFTVLECPNLKLKKPSWLHMPSAMTVYAMVVVSYFLITGGIIYDVIVEPPSVGSMTD-EHGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIILDRSNAPNIPKLNRFLLLFIGFVCVLLSFFMARVFMRMKLPGYL 147          
BLAST of FC875591 vs. ExPASy Swiss-Prot
Match: OSTCB_XENLA (Oligosaccharyltransferase complex subunit ostc-B OS=Xenopus laevis GN=ostc-B PE=2 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 1.235e-23
Identity = 57/141 (40.43%), Postives = 87/141 (61.70%), Query Frame = 3
Query:  177 PYSIIRPPRLRLKLPSFT-LPSPMTVFALVLLTYFMVVSGFVYDVIVEPPGIGSTQDPATGSVRPVVFLPGRVNGQYIIEGLSSXXXXXXXXXXXXXXDLALDKNRAKSVKVSYASAGISSIVIAYIMSMLFIRIKIPGYL 596
            P++++  P L+LK PS+  +PS MTV+A+V+++YF++  G +YDVIVEPP +GS  D   G  RPV FL  RVNGQYI+EGL+S              D +   N  K  +      G   +++++ M+ +F+R+K+PGYL
Sbjct:    8 PFTVLECPNLKLKKPSWLHMPSAMTVYAMVVVSYFLITGGIIYDVIVEPPSVGSMTD-EHGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIILDRSNAPNIPKLNRFLLLFIGFVCVLLSFFMARVFMRMKLPGYL 147          
BLAST of FC875591 vs. ExPASy Swiss-Prot
Match: OSTC_BOVIN (Oligosaccharyltransferase complex subunit OSTC OS=Bos taurus GN=OSTC PE=2 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 3.594e-23
Identity = 57/141 (40.43%), Postives = 85/141 (60.28%), Query Frame = 3
Query:  177 PYSIIRPPRLRLKLPSFT-LPSPMTVFALVLLTYFMVVSGFVYDVIVEPPGIGSTQDPATGSVRPVVFLPGRVNGQYIIEGLSSXXXXXXXXXXXXXXDLALDKNRAKSVKVSYASAGISSIVIAYIMSMLFIRIKIPGYL 596
            P+ ++  P L+LK P +  +PS MTV+ALV+++YF++  G +YDVIVEPP +GS  D   G  RPV FL  RVNGQYI+EGL+S              D +   N  K  +      G   +++++ M+ +F+R+K+PGYL
Sbjct:    8 PFLVLECPNLKLKKPPWVHMPSAMTVYALVVVSYFLITGGIIYDVIVEPPSVGSVTD-EHGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIILDRSNAPNIPKLNRFLLLFIGFVCVLLSFFMARVFMRMKLPGYL 147          
BLAST of FC875591 vs. ExPASy Swiss-Prot
Match: OSTC_RAT (Oligosaccharyltransferase complex subunit OSTC OS=Rattus norvegicus GN=Ostc PE=2 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 4.694e-23
Identity = 57/141 (40.43%), Postives = 85/141 (60.28%), Query Frame = 3
Query:  177 PYSIIRPPRLRLKLPSFT-LPSPMTVFALVLLTYFMVVSGFVYDVIVEPPGIGSTQDPATGSVRPVVFLPGRVNGQYIIEGLSSXXXXXXXXXXXXXXDLALDKNRAKSVKVSYASAGISSIVIAYIMSMLFIRIKIPGYL 596
            P+ ++  P L+LK P +  +PS MTV+ALV+++YF++  G +YDVIVEPP +GS  D   G  RPV FL  RVNGQYI+EGL+S              D +   N  K  +      G   +++++ M+ +F+R+K+PGYL
Sbjct:    8 PFLVLECPNLKLKKPPWVHMPSAMTVYALVVVSYFLITGGIIYDVIVEPPSVGSMTD-EHGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIILDRSNAPNIPKLNRFLLLFIGFVCVLLSFFMARVFMRMKLPGYL 147          
BLAST of FC875591 vs. ExPASy Swiss-Prot
Match: OSTC_MOUSE (Oligosaccharyltransferase complex subunit OSTC OS=Mus musculus GN=Ostc PE=2 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 4.694e-23
Identity = 57/141 (40.43%), Postives = 85/141 (60.28%), Query Frame = 3
Query:  177 PYSIIRPPRLRLKLPSFT-LPSPMTVFALVLLTYFMVVSGFVYDVIVEPPGIGSTQDPATGSVRPVVFLPGRVNGQYIIEGLSSXXXXXXXXXXXXXXDLALDKNRAKSVKVSYASAGISSIVIAYIMSMLFIRIKIPGYL 596
            P+ ++  P L+LK P +  +PS MTV+ALV+++YF++  G +YDVIVEPP +GS  D   G  RPV FL  RVNGQYI+EGL+S              D +   N  K  +      G   +++++ M+ +F+R+K+PGYL
Sbjct:    8 PFLVLECPNLKLKKPPWVHMPSAMTVYALVVVSYFLITGGIIYDVIVEPPSVGSMTD-EHGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIILDRSNAPNIPKLNRFLLLFIGFVCVLLSFFMARVFMRMKLPGYL 147          
BLAST of FC875591 vs. ExPASy Swiss-Prot
Match: OSTC_CANFA (Oligosaccharyltransferase complex subunit OSTC OS=Canis familiaris GN=OSTC PE=1 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 4.694e-23
Identity = 57/141 (40.43%), Postives = 85/141 (60.28%), Query Frame = 3
Query:  177 PYSIIRPPRLRLKLPSFT-LPSPMTVFALVLLTYFMVVSGFVYDVIVEPPGIGSTQDPATGSVRPVVFLPGRVNGQYIIEGLSSXXXXXXXXXXXXXXDLALDKNRAKSVKVSYASAGISSIVIAYIMSMLFIRIKIPGYL 596
            P+ ++  P L+LK P +  +PS MTV+ALV+++YF++  G +YDVIVEPP +GS  D   G  RPV FL  RVNGQYI+EGL+S              D +   N  K  +      G   +++++ M+ +F+R+K+PGYL
Sbjct:    8 PFLVLECPNLKLKKPPWVHMPSAMTVYALVVVSYFLITGGIIYDVIVEPPSVGSMTD-EHGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIILDRSNAPNIPKLNRFLLLFIGFVCVLLSFFMARVFMRMKLPGYL 147          
The following BLAST results are available for this feature:
BLAST of FC875591 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 11
Match NameE-valueIdentityDescription
OSTC_DROME5.545e-2438.30Putative oligosaccharyltransferase complex subunit... [more]
OSTC_DANRE7.242e-2440.43Oligosaccharyltransferase complex subunit ostc OS=... [more]
OSTC_CHICK7.242e-2440.43Oligosaccharyltransferase complex subunit OSTC OS=... [more]
OSTCA_XENLA9.458e-2440.43Oligosaccharyltransferase complex subunit ostc-A O... [more]
OSTC_XENTR1.235e-2340.43Oligosaccharyltransferase complex subunit ostc OS=... [more]
OSTCB_XENLA1.235e-2340.43Oligosaccharyltransferase complex subunit ostc-B O... [more]
OSTC_BOVIN3.594e-2340.43Oligosaccharyltransferase complex subunit OSTC OS=... [more]
OSTC_RAT4.694e-2340.43Oligosaccharyltransferase complex subunit OSTC OS=... [more]
OSTC_MOUSE4.694e-2340.43Oligosaccharyltransferase complex subunit OSTC OS=... [more]
OSTC_CANFA4.694e-2340.43Oligosaccharyltransferase complex subunit OSTC OS=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31405F05EF CTVClemen1 Citrus clementina cDNA clone C31405F05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875591 ID=FC875591|Name=FC875591|organism=Citrus clementina|type=EST|length=738bp
GGTTTTTATTATTTTTCTCTCCACGCCTTAGTCGTTTCGACTCTGATCCA
ATTCAGGACGATTCACATACTTCTGCAAAAATGGCTCCGAAAGCAGAAGC
AGCACAAACCCTCGCATCACAATCCGACGCATCGCAGTCGTCAATTGACC
CACTGTTCCACATCCTCAAAATCTTCCCTTACTCGATCATCCGCCCGCCG
CGTCTCCGCCTGAAGCTGCCGTCATTCACGCTCCCATCCCCAATGACCGT
CTTCGCCCTCGTCCTCCTAACCTACTTTATGGTCGTGTCGGGCTTCGTCT
ACGACGTCATCGTTGAGCCTCCTGGCATCGGGTCCACGCAGGACCCCGCC
ACCGGTTCCGTACGCCCCGTCGTCTTCCTACCCGGCCGCGTCAACGGGCA
GTACATCATCGAGGGACTCTCTTCTGGGTTCATGTTCGTGCTCGGCGGGA
TGGGCTTCGTGCTTTTGGATCTCGCTCTTGATAAGAATAGGGCTAAGAGT
GTTAAGGTCTCTTATGCCTCTGCTGGGATCTCTTCCATTGTCATTGCTTA
TATTATGAGTATGCTCTTTATTCGCATTAAGATCCCTGGTTATCTTAGGT
GAATTTTTATTTTCTTTTTTAATGCTGTTCGTTTACTTAGTTTTGATAAG
AGTTTAATTGGGTTGTGGATTTTTTTATGGTATTTGATCAGATTGTGNTA
TACATTTGCAATGAATGAAACTGCTATGAATTCCAGTG
back to top