FC875596

Overview
NameFC875596
Unique NameFC875596
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length737
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10274 contig Ccv1_Contig10274:1..737. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875596 vs. ExPASy Swiss-Prot
Match: TSJT1_TOBAC (Stem-specific protein TSJT1 OS=Nicotiana tabacum GN=TSJT1 PE=2 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 9.765e-29
Identity = 65/149 (43.62%), Postives = 92/149 (61.74%), Query Frame = 2
Query:  128 MLGVFSSAIVSPPEELVA--AGSRTPSPKTTSTALVDRFLQTNSSAVSVQVGDNVTLAYTHQNESPLRQRSFAVKDEIFCLFEGALDNLGSLRQQYGLAKSANEVILVIEAYKALRDRAPYPPNHVVGHLSGYFAFIVYDKSTSTLFVA 568
            ML VF  +I  PP EL    AG +    KT    + + F      +    + +   +A++H NE+PL+ RS  V D++FC+F GALDN   LR+ YGL++ A E ++++EAYK LRDRAPYPP+ V+  L G FAFI++D   STLF+A
Sbjct:    1 MLAVFEQSIGRPPPELSLPQAGIQKKEAKTREE-IAESFKTWKQDSTFYHLFNGNFMAFSHGNENPLQPRSIVVMDDVFCIFSGALDNTFDLRKHYGLSRQATEAMIMVEAYKVLRDRAPYPPDQVIKELEGKFAFILFDSKASTLFLA 148          
The following BLAST results are available for this feature:
BLAST of FC875596 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
TSJT1_TOBAC9.765e-2943.62Stem-specific protein TSJT1 OS=Nicotiana tabacum G... [more]
back to top
Properties
Property NameValue
Genbank descriptionC31405F10EF CTVClemen1 Citrus clementina cDNA clone C31405F10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875596 ID=FC875596|Name=FC875596|organism=Citrus clementina|type=EST|length=737bp
ATCCCAAGTCCGAGCTTTGAACTTTCCAGTTAAAGCCAAAGAGTTCCGAA
CGGATCAAAGTTTTCTTGTAGGAGAGAGAAATTTCTAGGGCGAGAAAGCG
AGAGAAAAGGAAATTTGGTAGCTTAAAATGTTGGGAGTGTTCAGCAGCGC
GATCGTTTCACCTCCAGAGGAGCTGGTGGCGGCCGGAAGCCGGACTCCGT
CGCCGAAGACCACATCGACGGCACTGGTCGACCGTTTCCTCCAGACCAAC
TCGTCTGCTGTGTCCGTACAGGTCGGGGACAACGTCACCCTCGCGTACAC
TCATCAGAACGAGTCTCCTTTACGGCAAAGATCATTTGCTGTGAAAGATG
AGATCTTTTGCTTGTTTGAGGGAGCACTTGATAACTTGGGAAGCCTGAGG
CAGCAATATGGACTAGCTAAGTCGGCAAATGAAGTGATCTTGGTGATTGA
GGCATACAAGGCTCTGCGTGATCGGGCCCCTTACCCACCGAACCATGTCG
TTGGCCACCTTAGTGGGTACTTTGCCTTCATTGTCTACGACAAGTCCACC
TCCACCTTGTTTGTGGCTTCTGTAGGTTTATTTAATTTCTTACCTACCAA
AAAACCTATGTGAAGCTTATCGCTTTGGTTGGTTTTGGATAGCAACTTTT
TAATATGTTAACACTGTGGCAGGACCATTTGGTAGGNTCCTCTTTATTGG
GGATCCTGCTGATGGACATGTGCCTTGCTGATGATGC
back to top