FC875607

Overview
NameFC875607
Unique NameFC875607
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length456
Libraries
Library NameType
CTVClemen1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig3817 contig Ccv1_Contig3817:1..456. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC875607 vs. ExPASy Swiss-Prot
Match: ISCU_HUMAN (Iron-sulfur cluster assembly enzyme ISCU, mitochondrial OS=Homo sapiens GN=ISCU PE=1 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 1.312e-28
Identity = 61/86 (70.93%), Postives = 72/86 (83.72%), Query Frame = 1
Query:    4 EETGQIVDACFKTFGCGSAIASSSVATEWVKGKQMQEVLSIKNTEIAKHLSLPPVKLHCSMLAEDAIKAAVKDYEAKRTKPSAASE 261
            +E G+IVDA FKTFGCGSAIASSS+ATEWVKGK ++E L+IKNT+IAK L LPPVKLHCSMLAEDAIKAA+ DY+ K+      +E
Sbjct:   80 DEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPKKGEAE 165          
BLAST of FC875607 vs. ExPASy Swiss-Prot
Match: ISCU_MOUSE (Iron-sulfur cluster assembly enzyme ISCU, mitochondrial OS=Mus musculus GN=Iscu PE=1 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 1.714e-28
Identity = 61/88 (69.32%), Postives = 72/88 (81.82%), Query Frame = 1
Query:    4 EETGQIVDACFKTFGCGSAIASSSVATEWVKGKQMQEVLSIKNTEIAKHLSLPPVKLHCSMLAEDAIKAAVKDYEAKRTKPSAASEAE 267
            +E G+IVDA FKTFGCGSAIASSS+ATEWVKGK ++E L+IKNT+IAK L LPPVKLHCSMLAEDAIKAA+ DY+ K+       E +
Sbjct:   81 DEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQESKKEEPEKQ 168          
BLAST of FC875607 vs. ExPASy Swiss-Prot
Match: ISU1_DEBHA (Iron sulfur cluster assembly protein 1, mitochondrial OS=Debaryomyces hansenii GN=ISU1 PE=3 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 1.895e-27
Identity = 63/90 (70.00%), Postives = 72/90 (80.00%), Query Frame = 1
Query:    1 DEETGQIVDACFKTFGCGSAIASSSVATEWVKGKQMQEVLSIKNTEIAKHLSLPPVKLHCSMLAEDAIKAAVKDYEAKRT--KPSAASEA 264
            D+ETG I D  FKTFGCGSAIASSS  TE VKGK ++E + IKNT IAK LSLPPVKLHCSMLAEDAIK+AVKDY +KR+  +P+   EA
Sbjct:   82 DDETGVIKDVKFKTFGCGSAIASSSYLTELVKGKTIEEAVKIKNTAIAKELSLPPVKLHCSMLAEDAIKSAVKDYRSKRSVKQPTLGPEA 171          
BLAST of FC875607 vs. ExPASy Swiss-Prot
Match: ISU1_KLULA (Iron sulfur cluster assembly protein 1, mitochondrial OS=Kluyveromyces lactis GN=ISU1 PE=3 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 3.573e-26
Identity = 57/79 (72.15%), Postives = 67/79 (84.81%), Query Frame = 1
Query:    1 DEETGQIVDACFKTFGCGSAIASSSVATEWVKGKQMQEVLSIKNTEIAKHLSLPPVKLHCSMLAEDAIKAAVKDYEAKR 237
            ++ETG I +  FKTFGCGSAIASSS  TE V+GK +++   IKNTEIA+ LSLPPVKLHCSMLAEDAIKAA+KDY+AKR
Sbjct:   96 NDETGVIENVKFKTFGCGSAIASSSYMTELVRGKTLEDAAKIKNTEIARELSLPPVKLHCSMLAEDAIKAAIKDYQAKR 174          
BLAST of FC875607 vs. ExPASy Swiss-Prot
Match: NIFU_RICPR (NifU-like protein OS=Rickettsia prowazekii GN=nifU PE=3 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 4.667e-26
Identity = 55/73 (75.34%), Postives = 63/73 (86.30%), Query Frame = 1
Query:   19 IVDACFKTFGCGSAIASSSVATEWVKGKQMQEVLSIKNTEIAKHLSLPPVKLHCSMLAEDAIKAAVKDYEAKR 237
            I DA FKTFGCGSAIASSS+ TEW+KGK +++   IKNTEIAK LSLPPVKLHCS+LAEDAIKAA+ DY+ KR
Sbjct:   53 ITDAKFKTFGCGSAIASSSLVTEWIKGKSVEDAKEIKNTEIAKELSLPPVKLHCSLLAEDAIKAAIADYKQKR 125          
BLAST of FC875607 vs. ExPASy Swiss-Prot
Match: ISU1_YEAST (Iron sulfur cluster assembly protein 1, mitochondrial OS=Saccharomyces cerevisiae GN=ISU1 PE=1 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 4.667e-26
Identity = 58/86 (67.44%), Postives = 67/86 (77.91%), Query Frame = 1
Query:    1 DEETGQIVDACFKTFGCGSAIASSSVATEWVKGKQMQEVLSIKNTEIAKHLSLPPVKLHCSMLAEDAIKAAVKDYEAKRTKPSAAS 258
            ++ TG I D  FKTFGCGSAIASSS  TE V+G  + +   IKNTEIAK LSLPPVKLHCSMLAEDAIKAA+KDY++KR  P+  S
Sbjct:   80 NDSTGVIEDVKFKTFGCGSAIASSSYMTELVQGMTLDDAAKIKNTEIAKELSLPPVKLHCSMLAEDAIKAAIKDYKSKRNTPTMLS 165          
BLAST of FC875607 vs. ExPASy Swiss-Prot
Match: NIFU_BUCAP (NifU-like protein OS=Buchnera aphidicola subsp. Schizaphis graminum GN=nifU PE=3 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 6.095e-26
Identity = 53/79 (67.09%), Postives = 65/79 (82.28%), Query Frame = 1
Query:    7 ETGQIVDACFKTFGCGSAIASSSVATEWVKGKQMQEVLSIKNTEIAKHLSLPPVKLHCSMLAEDAIKAAVKDYEAKRTK 243
            E G I DACFKT+GCGSAIASSS+ TEW+KGK + E  +IKNT I + L LPPVK+HCS+LAEDAIKAA+ DY++K+ K
Sbjct:   49 EQGIIEDACFKTYGCGSAIASSSLVTEWIKGKSITEAEAIKNTSIVEELELPPVKIHCSILAEDAIKAAISDYKSKKNK 127          
BLAST of FC875607 vs. ExPASy Swiss-Prot
Match: NIFU_BUCAI (NifU-like protein OS=Buchnera aphidicola subsp. Acyrthosiphon pisum GN=nifU PE=3 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 7.960e-26
Identity = 54/77 (70.13%), Postives = 64/77 (83.12%), Query Frame = 1
Query:    7 ETGQIVDACFKTFGCGSAIASSSVATEWVKGKQMQEVLSIKNTEIAKHLSLPPVKLHCSMLAEDAIKAAVKDYEAKR 237
            E G I DACFKT+GCGSAIASSS+ TEWVKGK ++E  SIKNT I + L LPPVK+HCS+LAEDAIKAA+ DY+ K+
Sbjct:   49 EKGIIEDACFKTYGCGSAIASSSLVTEWVKGKSIEEAESIKNTTIVEELDLPPVKIHCSILAEDAIKAAISDYKRKK 125          
BLAST of FC875607 vs. ExPASy Swiss-Prot
Match: NIFU_SHIFL (NifU-like protein OS=Shigella flexneri GN=nifU PE=3 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 5.160e-25
Identity = 53/77 (68.83%), Postives = 65/77 (84.42%), Query Frame = 1
Query:    7 ETGQIVDACFKTFGCGSAIASSSVATEWVKGKQMQEVLSIKNTEIAKHLSLPPVKLHCSMLAEDAIKAAVKDYEAKR 237
            + G I DA FKT+GCGSAIASSS+ TEWVKGK + E  +IKNT+IA+ L LPPVK+HCS+LAEDAIKAA+ DY++KR
Sbjct:   49 DEGIIEDARFKTYGCGSAIASSSLVTEWVKGKSLDEAQAIKNTDIAEELELPPVKIHCSILAEDAIKAAIADYKSKR 125          
BLAST of FC875607 vs. ExPASy Swiss-Prot
Match: NIFU_ECOLI (NifU-like protein OS=Escherichia coli (strain K12) GN=nifU PE=1 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 5.160e-25
Identity = 53/77 (68.83%), Postives = 65/77 (84.42%), Query Frame = 1
Query:    7 ETGQIVDACFKTFGCGSAIASSSVATEWVKGKQMQEVLSIKNTEIAKHLSLPPVKLHCSMLAEDAIKAAVKDYEAKR 237
            + G I DA FKT+GCGSAIASSS+ TEWVKGK + E  +IKNT+IA+ L LPPVK+HCS+LAEDAIKAA+ DY++KR
Sbjct:   49 DEGIIEDARFKTYGCGSAIASSSLVTEWVKGKSLDEAQAIKNTDIAEELELPPVKIHCSILAEDAIKAAIADYKSKR 125          
The following BLAST results are available for this feature:
BLAST of FC875607 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 27
Match NameE-valueIdentityDescription
ISCU_HUMAN1.312e-2870.93Iron-sulfur cluster assembly enzyme ISCU, mitochon... [more]
ISCU_MOUSE1.714e-2869.32Iron-sulfur cluster assembly enzyme ISCU, mitochon... [more]
ISU1_DEBHA1.895e-2770.00Iron sulfur cluster assembly protein 1, mitochondr... [more]
ISU1_KLULA3.573e-2672.15Iron sulfur cluster assembly protein 1, mitochondr... [more]
NIFU_RICPR4.667e-2675.34NifU-like protein OS=Rickettsia prowazekii GN=nifU... [more]
ISU1_YEAST4.667e-2667.44Iron sulfur cluster assembly protein 1, mitochondr... [more]
NIFU_BUCAP6.095e-2667.09NifU-like protein OS=Buchnera aphidicola subsp. Sc... [more]
NIFU_BUCAI7.960e-2670.13NifU-like protein OS=Buchnera aphidicola subsp. Ac... [more]
NIFU_SHIFL5.160e-2568.83NifU-like protein OS=Shigella flexneri GN=nifU PE=... [more]
NIFU_ECOLI5.160e-2568.83NifU-like protein OS=Escherichia coli (strain K12)... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC31405G09EF CTVClemen1 Citrus clementina cDNA clone C31405G09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC875607 ID=FC875607|Name=FC875607|organism=Citrus clementina|type=EST|length=456bp
GATGAAGAGACTGGTCAGATCGTCGACGCCTGCTTCAAGACCTTTGGCTG
TGGCTCGGCCATCGCTTCATCTTCTGTTGCAACGGAATGGGTGAAAGGGA
AGCAGATGCAGGAAGTCTTGTCCATTAAAAACACGGAAATTGCAAAACAT
CTTTCTCTACCACCTGTTAAACTGCATTGCAGCATGCTTGCTGAAGATGC
TATCAAGGCTGCTGTAAAAGATTACGAAGCTAAACGTACCAAACCAAGTG
CTGCTTCAGAGGCAGAACTACCTCCAAGGGCTGCTGATGTTTGAAGATAT
TGATGTAAACATTTGAAAATGATGTTAATGTTCTGCCCGTGGAGATGTAT
CAGGATAACTGCACCTCCTAAAGATTGATGTCGGGTGGTGGAGGGGGNTA
AGTTTATGGTTATTAGTAAGAACTGTGTATGAATATGATCCAGGGACTGC
AGNTTT
back to top