FC876162

Overview
NameFC876162
Unique NameFC876162
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length361
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10311 contig Ccv1_Contig10311:2..362. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876162 vs. ExPASy Swiss-Prot
Match: METE_MESCR (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Mesembryanthemum crystallinum GN=METE PE=2 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 1.595e-53
Identity = 99/106 (93.40%), Postives = 103/106 (97.17%), Query Frame = 1
Query:   43 MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRSSIWKQMSEAGIKYIPSNTFSYYDQVLDTTAMLGAVPPRYNWNGGEIGFDVYFSMARGNASVPA 360
            MASHIVGYPRMGPKRELKFALESFWDGKS+AEDL+KVSADLRSSIWKQM++AGIKYIPSNTFSYYDQVLDTTAMLGAVPPRY W GGEI FDVYFSMARGNASVPA
Sbjct:    1 MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLKKVSADLRSSIWKQMADAGIKYIPSNTFSYYDQVLDTTAMLGAVPPRYGWTGGEIEFDVYFSMARGNASVPA 106          
BLAST of FC876162 vs. ExPASy Swiss-Prot
Match: METE_CATRO (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Catharanthus roseus GN=METE PE=2 SV=1)

HSP 1 Score: 201.83 bits (512), Expect = 8.750e-52
Identity = 97/106 (91.51%), Postives = 101/106 (95.28%), Query Frame = 1
Query:   43 MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRSSIWKQMSEAGIKYIPSNTFSYYDQVLDTTAMLGAVPPRYNWNGGEIGFDVYFSMARGNASVPA 360
            MASHIVGYPRMGPKRELKFALESFWD KSSAEDLQKV+ADLRSSIWKQM++AGIKYIPSNTFSYYDQVLDT  MLGAVPPRYN+ GGEIGFD YFSMARGNASVPA
Sbjct:    1 MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLQKVAADLRSSIWKQMADAGIKYIPSNTFSYYDQVLDTATMLGAVPPRYNFAGGEIGFDTYFSMARGNASVPA 106          
BLAST of FC876162 vs. ExPASy Swiss-Prot
Match: METE_ARATH (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Arabidopsis thaliana GN=CIMS PE=1 SV=1)

HSP 1 Score: 199.904 bits (507), Expect = 3.325e-51
Identity = 96/106 (90.57%), Postives = 101/106 (95.28%), Query Frame = 1
Query:   43 MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRSSIWKQMSEAGIKYIPSNTFSYYDQVLDTTAMLGAVPPRYNWNGGEIGFDVYFSMARGNASVPA 360
            MASHIVGYPRMGPKRELKFALESFWDGKS+AEDLQKVSADLRSSIWKQMS AG K+IPSNTF++YDQVLDTTAMLGAVPPRY + GGEIG DVYFSMARGNASVPA
Sbjct:    1 MASHIVGYPRMGPKRELKFALESFWDGKSTAEDLQKVSADLRSSIWKQMSAAGTKFIPSNTFAHYDQVLDTTAMLGAVPPRYGYTGGEIGLDVYFSMARGNASVPA 106          
BLAST of FC876162 vs. ExPASy Swiss-Prot
Match: METE_SOLSC (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Solenostemon scutellarioides GN=MET PE=1 SV=2)

HSP 1 Score: 186.422 bits (472), Expect = 3.804e-47
Identity = 92/106 (86.79%), Postives = 95/106 (89.62%), Query Frame = 1
Query:   43 MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRSSIWKQMSEAGIKYIPSNTFSYYDQVLDTTAMLGAVPPRYNWNGGEIGFDVYFSMARGNASVPA 360
            MASHIVGYPRMGPKRELKFALESFWDGKSSAEDL+K    L   + KQMS+AGIKYIPSNTFSYYDQVLDTTAMLGAVPPRYNW GGEIGF  YFSMARGNASVPA
Sbjct:    1 MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKCQLILGIHL-KQMSDAGIKYIPSNTFSYYDQVLDTTAMLGAVPPRYNWTGGEIGFSTYFSMARGNASVPA 105          
BLAST of FC876162 vs. ExPASy Swiss-Prot
Match: METE_RHILO (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Rhizobium loti GN=metE PE=3 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 8.811e-28
Identity = 55/96 (57.29%), Postives = 69/96 (71.88%), Query Frame = 1
Query:   58 VGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRSSIWKQMSEAGIKYIPSNTFSYYDQVLDTTAMLGAVPPRYNWNGGEIGFDVYFSMARGN 345
            +G PR+G +RELKFALES+W GKS A DL   +  LR++ W++  + G+  IPSN FS YD VLDT AM+GAVP RY W  GE+  D YF+MARGN
Sbjct:    4 LGVPRIGRRRELKFALESYWSGKSPAADLLATAKALRAASWREQHDRGVSKIPSNDFSLYDHVLDTVAMVGAVPARYTWTDGEVPLDTYFAMARGN 99          
BLAST of FC876162 vs. ExPASy Swiss-Prot
Match: METE_CAUCR (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Caulobacter crescentus GN=metE PE=3 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 3.348e-27
Identity = 51/101 (50.50%), Postives = 71/101 (70.30%), Query Frame = 1
Query:   58 VGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRSSIWKQMSEAGIKYIPSNTFSYYDQVLDTTAMLGAVPPRYNWNGGEIGFDVYFSMARGNASVPA 360
            +G+PR+GPKRELKFALE++W GK+ A+ L   + DLR+  W + +  G+ ++PSN FS YD VLDT  M+GA+P  Y W+GG +    YF+MARG+   PA
Sbjct:    8 LGFPRIGPKRELKFALEAYWAGKTDADALLDTARDLRAKTWTRQAALGVAHVPSNDFSLYDHVLDTAVMVGAIPAAYGWSGGTVDLATYFAMARGDQGRPA 108          
BLAST of FC876162 vs. ExPASy Swiss-Prot
Match: METE_RHOPT (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Rhodopseudomonas palustris (strain TIE-1) GN=metE PE=3 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 4.373e-27
Identity = 56/100 (56.00%), Postives = 71/100 (71.00%), Query Frame = 1
Query:   43 MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRSSIWKQMSEAGIKYIPSNTFSYYDQVLDTTAMLGAVPPRYNWNGGEIGFDVYFSMARG 342
            +A   +G PR+GP+RELK ALESFW GKS+  DL KV+A LR++ W + S  G+  IPSN FS YDQVLDT+ M+GA+P  Y W GG +    YF+MARG
Sbjct:   10 LAVATLGTPRIGPRRELKSALESFWAGKSTEADLLKVAAALRAANWARQSARGVSVIPSNDFSLYDQVLDTSVMVGAIPEIYGWRGGPVSLATYFAMARG 109          
BLAST of FC876162 vs. ExPASy Swiss-Prot
Match: METE_RHOPA (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Rhodopseudomonas palustris GN=metE PE=3 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 4.373e-27
Identity = 56/100 (56.00%), Postives = 71/100 (71.00%), Query Frame = 1
Query:   43 MASHIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRSSIWKQMSEAGIKYIPSNTFSYYDQVLDTTAMLGAVPPRYNWNGGEIGFDVYFSMARG 342
            +A   +G PR+GP+RELK ALESFW GKS+  DL KV+A LR++ W + S  G+  IPSN FS YDQVLDT+ M+GA+P  Y W GG +    YF+MARG
Sbjct:   10 LAVATLGTPRIGPRRELKSALESFWAGKSTEADLLKVAAALRAANWARQSARGVSVIPSNDFSLYDQVLDTSVMVGAIPEIYGWRGGPVSLATYFAMARG 109          
BLAST of FC876162 vs. ExPASy Swiss-Prot
Match: METE_STRCO (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Streptomyces coelicolor GN=metE PE=3 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 3.465e-24
Identity = 49/100 (49.00%), Postives = 70/100 (70.00%), Query Frame = 1
Query:   55 IVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRSSIWKQMSEAGIKYIPSNTFSYYDQVLDTTAMLGAVPPRYNWNGGEIGFDVYFSMARGNASV 354
            + GYPR GP RELK A+E +W G+ SA +L+ ++ADLR++ W+++++AGI  +P+  FSYYD VLDTT M+GA+P R+         D YF+MARG   V
Sbjct:   14 VYGYPRQGPNRELKKAIEGYWKGRVSAPELRSLAADLRAANWRRLADAGIDEVPAGDFSYYDHVLDTTVMVGAIPERHRAAVAADALDGYFAMARGTQEV 113          
BLAST of FC876162 vs. ExPASy Swiss-Prot
Match: METE_ACIF5 (5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=metE PE=3 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 4.525e-24
Identity = 49/103 (47.57%), Postives = 69/103 (66.99%), Query Frame = 1
Query:   52 HIVGYPRMGPKRELKFALESFWDGKSSAEDLQKVSADLRSSIWKQMSEAGIKYIPSNTFSYYDQVLDTTAMLGAVPPRYNWNGGEIGFDVYFSMARGNASVPA 360
            H +G+PR+G KRELK ALESFW  +   ++LQ  +A LR   W+     G+  +P   FS YD +LD +  LGA+PPRY + GG++G D +F+MARG+A+ PA
Sbjct:    5 HSLGFPRIGHKRELKKALESFWSREIDEQELQSRAAQLRDRHWRIQQTCGMDLVPVGDFSLYDHMLDMSCTLGAIPPRYGFAGGQVGLDTFFAMARGSATQPA 107          
The following BLAST results are available for this feature:
BLAST of FC876162 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 266
Match NameE-valueIdentityDescription
METE_MESCR1.595e-5393.405-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_CATRO8.750e-5291.515-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_ARATH3.325e-5190.575-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_SOLSC3.804e-4786.795-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_RHILO8.811e-2857.295-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_CAUCR3.348e-2750.505-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_RHOPT4.373e-2756.005-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_RHOPA4.373e-2756.005-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_STRCO3.465e-2449.005-methyltetrahydropteroyltriglutamate--homocystein... [more]
METE_ACIF54.525e-2447.575-methyltetrahydropteroyltriglutamate--homocystein... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001A06EF DevOvary1 Citrus clementina cDNA clone C32001A06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876162 ID=FC876162|Name=FC876162|organism=Citrus clementina|type=EST|length=361bp
CTCGACTCTCAATTTCTCTGCTCTTCTTTCTCTGTTTGTAAAATGGCATC
TCACATCGTTGGATACCCACGCATGGGCCCCAAGAGGGAGCTCAAGTTCG
CGTTGGAATCCTTCTGGGATGGCAAGAGCAGCGCCGAGGATTTGCAAAAG
GTGTCCGCTGATCTCAGATCCTCCATCTGGAAACAGATGTCCGAGGCCGG
GATCAAATACATTCCCAGCAACACTTTCTCCTACTACGACCAAGTGCTCG
ACACCACCGCAATGCTCGGTGCCGTGCCACCTAGGTATAACTGGAACGGC
GGCGAGATTGGATTCGATGTTTACTTCTCCATGGCCAGAGGAAACGCCTC
TGTTCCCGCTA
back to top