FC876209

Overview
NameFC876209
Unique NameFC876209
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length667
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10894 contig Ccv1_Contig10894:38..704. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876209 vs. ExPASy Swiss-Prot
Match: C81E1_GLYEC (Isoflavone 2'-hydroxylase OS=Glycyrrhiza echinata GN=CYP81E1 PE=1 SV=2)

HSP 1 Score: 172.94 bits (437), Expect = 1.297e-42
Identity = 89/193 (46.11%), Postives = 127/193 (65.80%), Query Frame = 2
Query:   95 SLALYLPIFLALYVLTKQFLN--KIRRLPPSPFLELPIIGHLYLLKRPIHRTLSNLSKRHGPILLLRFGSRRVLVVSSPPAAEECFTKNDIVFANRPSLMVGKHMGCNFTSLAWAPYGDHWRNLRRVASLEILSSSRLQLLSNIRADEVKSLVRRLFHNQL--IESVDLRMEIYDLTMNVMMRMIAGKRYYGK 661
            SL  Y   +LAL+ +    +   K + LPP P   LPIIG+L+ LKRP+HRT   LS+++G +  L FGSR V+VVSS    ++CFTKND+V ANRP  + GK++  N+T+L    YG+HWRNLRR+ +L++LS+ R+   S IR DE + L+ RL  +       ++L   +YD+T N +MRMI+GKRYYG+
Sbjct:    5 SLLSYSVFYLALFFIFNIVIRARKFKNLPPGP-PSLPIIGNLHHLKRPLHRTFKGLSEKYGHVFSLWFGSRLVVVVSSASEFQQCFTKNDVVLANRPRFLSGKYIFYNYTTLGSTSYGEHWRNLRRITALDVLSNHRINSFSGIRRDETQRLITRLADDSSTNFAEMELSSRLYDMTFNNIMRMISGKRYYGE 196          
BLAST of FC876209 vs. ExPASy Swiss-Prot
Match: C81D1_ARATH (Cytochrome P450 81D1 OS=Arabidopsis thaliana GN=CYP81D1 PE=2 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 3.772e-42
Identity = 98/197 (49.75%), Postives = 129/197 (65.48%), Query Frame = 2
Query:   98 LALYLPIFLALYVLTKQFLN-KIRRLPPSPFLELPIIGHLYLLKRPIHRTLSNLSKR-----HGPILLLRFGSRRVLVVSSPP-AAEECFTKNDIVFANRPSLMVGKHMGCNFTSLAWAPYGDHWRNLRRVASLEILSSSRLQLLSNIRADEVKSLVRRLFHNQLIES--VDLRMEIYDLTMNVMMRMIAGKRYYGK 661
            + LY    L   +++ +FL  K + LPPSP   LPIIGHL LLK PIHRTL + S+       G ++ LR GSR V VVSS   AAEECF KND+V ANRP +++GKH+G N T++  APYGDHWRNLRR+ ++EI S+ RL     +R DEV+ L+ RL      +   V+L+  + DLT N +MRM+ GKRYYG+
Sbjct:    8 VVLYSIFSLIFLIISFKFLKPKKQNLPPSPPGWLPIIGHLRLLKPPIHRTLRSFSETLDHNDGGGVMSLRLGSRLVYVVSSHKVAAEECFGKNDVVLANRPQVIIGKHVGYNNTNMIAAPYGDHWRNLRRLCTIEIFSTHRLNCFLYVRTDEVRRLISRLSRLAGTKKTVVELKPMLMDLTFNNIMRMMTGKRYYGE 204          
BLAST of FC876209 vs. ExPASy Swiss-Prot
Match: C81F1_ARATH (Cytochrome P450 81F1 OS=Arabidopsis thaliana GN=CYP81F1 PE=2 SV=2)

HSP 1 Score: 158.303 bits (399), Expect = 3.305e-38
Identity = 91/198 (45.96%), Postives = 126/198 (63.64%), Query Frame = 2
Query:  104 LYLPIFLALYVLTKQFLNKIRR--LPPSPFLELPIIGHLYLLKRPIHRTLSNLSKRHGPILLLRFGSRRVLVVSSPPAAEECFT-KNDIVFANRPSLMVGKHMGCNFTSLAWAPYGDHWRNLRRVASLEILSSSRLQLLSNIRADEVKSLVRRLFH-----NQLIESVDLRME--IYDLTMNVMMRMIAGKRYYGKHV 667
            + LP+ L L +  K   +K +R  LPP P    P +GHL+L+K PIHR L   S ++GPI  LRFGSRRV+V++SP  A+E FT +NDIV ++RP  +  K++  N T++  APYGDHWRNLRR+ S EILSS RL    +IR DE+  ++ RL       N+  +   + +E  + DLT N ++RM+ GKRYYG  V
Sbjct:    5 ILLPL-LFLVISYKFLYSKTQRFNLPPGP-PSRPFVGHLHLMKPPIHRLLQRYSNQYGPIFSLRFGSRRVVVITSPSLAQESFTGQNDIVLSSRPLQLTAKYVAYNHTTVGTAPYGDHWRNLRRICSQEILSSHRLINFQHIRKDEILRMLTRLSRYTQTSNESNDFTHIELEPLLSDLTFNNIVRMVTGKRYYGDDV 200          
BLAST of FC876209 vs. ExPASy Swiss-Prot
Match: C75A1_PINTA (Cytochrome P450 750A1 OS=Pinus taeda GN=CYP750A1 PE=2 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 1.942e-30
Identity = 65/180 (36.11%), Postives = 115/180 (63.89%), Query Frame = 2
Query:  119 FLALYVLTKQFLNKIRRLPPSPFLELPIIGHLYLLKRPIHRTLSNLSKRHGPILLLRFGSRRVLVVSSPPAAEECFTKNDIVFANRPSLMVGKHMGCNFTSLAWAPYGDHWRNLRRVASLEILSSSRLQLLSNIRADEVKSLVRRLFHNQLIE--SVDLRMEIYDLTMNVMMRMIAGKRY 652
            F + ++L +   N+  RLPP P+   PIIG+ + ++ P+HRTL NL++++GPIL LRFGS   +VVSS   A+     +D++FA+RP   VGK+   NF  +A++PYGDHWR +R++  LE+L+S R++   ++R +E+ +++  ++        +V++   I     N++ R++A K++
Sbjct:   27 FFSCWILHQSQRNE--RLPPGPY-PWPIIGNFHQVRLPLHRTLKNLAEKYGPILFLRFGSVPTVVVSSSEKAKHFLKTHDLIFASRPPTSVGKYFFYNFKDIAFSPYGDHWRKMRKICVLELLTSKRIESFKHVRQEELSAMIHSIWEESESGRIAVNVSKAISTSLANILWRILARKKF 203          
BLAST of FC876209 vs. ExPASy Swiss-Prot
Match: C82A1_PEA (Cytochrome P450 82A1 (Fragment) OS=Pisum sativum GN=CYP82A1 PE=2 SV=2)

HSP 1 Score: 123.25 bits (308), Expect = 1.178e-27
Identity = 69/190 (36.32%), Postives = 110/190 (57.89%), Query Frame = 2
Query:  173 PPSPFLELPIIGHLYLLK--RPIHRTLSNLSKRHGPILLLRFGSRRVLVVSSPPAAEECFTKNDIVFANRPSLMVGKHMGCNFTSLAWAPYGDHWRNLRRVASLEILSSSRLQLLSNIRADEVKSLVRRL---FHNQLIE-----------------------SVDLRMEIYDLTMNVMMRMIAGKRYYG 658
            PP      P++GHL L++  +  H+TL  L  ++GPI  ++ G+   LV+S+   A+ECFTKNDIV ++RP  +  + M  N   + WAPYG +WR LR++ +LEILS+ R++LLS+IR  EV++ ++ L   + NQ+                         SV+L+     LT+N+++RM+ GKR +G
Sbjct:   35 PPIISGSWPLLGHLPLMRNTQTPHKTLGALVDKYGPIFTIKLGATNALVLSNWELAKECFTKNDIVVSSRPKPVAVELMSYNQAFIGWAPYGAYWRQLRKIVTLEILSNRRIELLSHIRVSEVQTSIKELVNVWSNQISSQYGLLDDTKSSSTNDEPSTTDYVSVELKKWFAQLTLNMVLRMVVGKRCFG 224          
BLAST of FC876209 vs. ExPASy Swiss-Prot
Match: C71BM_ARATH (Cytochrome P450 71B22 OS=Arabidopsis thaliana GN=CYP71B22 PE=2 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 5.847e-27
Identity = 67/189 (35.45%), Postives = 113/189 (59.79%), Query Frame = 2
Query:   95 SLALYLPIFLALYVLTKQFLNKIR-RLPPSPFLELPIIGHLYLLKRPIHRTLSNLSKRHGPILLLRFGSRRVLVVSSPPAAEECFTKNDIVFANRPSLMVGKHMGCNFTSLAWAPYGDHWRNLRRVASLEILSSSRLQLLSNIRADEVKSLVRRLFHN-QLIESVDLRMEIYDLTMNVMMRMIAGKRYY 655
            S++LY  + L L+++  + L+  + +LPP P L LPIIG+L+ L + +HR+   LS+ +GP++ L FG   V+VVS+  AAEE    +D+    RP L   K    N+  + +A YGD WR +R++A LE+ SS +L+    IR +E + LV +L  + +    VDLR  ++  T +++ R+  G+ ++
Sbjct:    2 SISLYFLLLLPLFLIFFKKLSPSKGKLPPGP-LGLPIIGNLHQLGKSLHRSFHKLSQNYGPVMFLHFGVVPVVVVSTREAAEEVLKTHDLETCTRPKLTATKLFSYNYKDIGFAQYGDDWREMRKLAMLELFSSKKLKAFRYIREEESEVLVNKLSKSAETRTMVDLRKALFSYTASIVCRLAFGQNFH 189          
BLAST of FC876209 vs. ExPASy Swiss-Prot
Match: C71BL_ARATH (Cytochrome P450 71B21 OS=Arabidopsis thaliana GN=CYP71B21 PE=2 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 5.847e-27
Identity = 66/185 (35.68%), Postives = 109/185 (58.92%), Query Frame = 2
Query:  104 LYLPIFLALYVLTKQFLNKIRRLPPSPFLELPIIGHLYLLKRPIHRTLSNLSKRHGPILLLRFGSRRVLVVSSPPAAEECFTKNDIVFANRPSLMVGKHMGCNFTSLAWAPYGDHWRNLRRVASLEILSSSRLQLLSNIRADEVKSLVRRLFHNQLIES-VDLRMEIYDLTMNVMMRMIAGKRYY 655
            L LP+FL  Y   K+ L    +LPP P + LPIIG+L+ L + +HR+   LS+ +GP++ LRFG   V+V S+  AAEE    +D+    RP L        NF  + +A YG+ WR +R++A LE+ SS +L+    IR +E + LV+++  +   ++ VDLR  ++  T +++ R+  G+ ++
Sbjct:    9 LLLPLFLVFY---KRLLPSKGKLPPGP-ISLPIIGNLHQLGKSLHRSFYKLSQEYGPVMFLRFGVVPVVVFSTKEAAEEVLKTHDLETCTRPKLSATGLFTYNFKDIGFAQYGEDWREMRKLAMLELFSSKKLKAFRYIREEESELLVKKVTESAQTQTLVDLRKALFSYTASIVCRLAFGQNFH 189          
BLAST of FC876209 vs. ExPASy Swiss-Prot
Match: C71AG_ARATH (Cytochrome P450 71A16 OS=Arabidopsis thaliana GN=CYP71A16 PE=2 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 5.847e-27
Identity = 69/190 (36.32%), Postives = 110/190 (57.89%), Query Frame = 2
Query:   98 LALYLPIFLALYVLTKQFLNKIR-RLPPSPFLELPIIGHLYLLKRPIHRTLSNLSKRHGPILLLRFGSRRVLVVSSPPAAEECFTKNDIVFANRPSLMVGKHMGCNFTSLAWAPYGDHWRNLRRVASLEILSSSRLQLLSNIRADEVKSLVRRLFHNQL-IESVDLRMEIYDLTMNVMMRMIAGKRYYGK 661
            ++L L  FL + +  K  L +    LPPSP+  LP+IG+L+ L    HR LS+LS RHGP++LLRFG   VL+VSS   A +    +D+ FANRP       +      L +APYG++WRN++ + ++ +LS+  +Q     R +E+  L+  L    L   SV+L   I ++  ++M +++ GK+Y G+
Sbjct:    7 ISLCLTTFLTILLFFKSLLKRPNSNLPPSPW-RLPVIGNLHQLSLHPHRALSSLSARHGPLMLLRFGRVPVLIVSSADVAHDVMKTHDLKFANRPITKSAHKISNGGRDLVFAPYGEYWRNVKSLCTIHLLSNKMVQSSEKRREEEITLLMETLEEASLSSSSVNLSKLITNMVSDIMGKVVLGKKYSGE 195          
BLAST of FC876209 vs. ExPASy Swiss-Prot
Match: C71A6_NEPRA (Cytochrome P450 71A6 (Fragment) OS=Nepeta racemosa GN=CYP71A6 PE=2 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 4.950e-26
Identity = 68/179 (37.99%), Postives = 107/179 (59.78%), Query Frame = 2
Query:  149 FLNKIRRL------PPSPFLELPIIGHLYLLKRPIHRTLSNLSKRHGPILLLRFGSRRVLVVSSPPAAEECFTKNDIVFANRPSLMVGKHMGCNFTSLAWAPYGDHWRNLRRVASLEILSSSRLQLLSNIRADEVKSLVRRLFHNQL---IESVDLRMEIYDLTMNVMMRMIAGKRYYG 658
            FL K RR       PPSP  +LP++G+L+ L    HR+L +LS+R+GP++ L FGS  VLV SSP AA E     D+ F+NRP+L + + +  +   +A+APYG++WR +R +  L++LS+ R+Q    +R +E   +V ++   Q      +V+L   +  LT +V  R+  GK+Y G
Sbjct:   14 FLKKWRRSYSGKTPPPSP-PKLPVLGNLHQLGTFPHRSLQSLSRRYGPVMQLHFGSVPVLVASSPEAAREIMKNQDLNFSNRPNLSIPRRLLYDNHDVAFAPYGEYWRQIRSICVLQLLSNKRVQSFRRVREEETSIMVEKIMQLQKTTPTAAVNLTDLLTCLTNDVFCRIALGKKYGG 191          
BLAST of FC876209 vs. ExPASy Swiss-Prot
Match: C71D8_SOYBN (Cytochrome P450 71D8 OS=Glycine max GN=CYP71D8 PE=2 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 8.443e-26
Identity = 68/188 (36.17%), Postives = 108/188 (57.45%), Query Frame = 2
Query:   95 SLALYLPIFLALYVLTKQFLNKI-RRLPPSPFLELPIIGHLYLLKRPIH---RTLSNLSKRHGPILLLRFGSRRVLVVSSPPAAEECFTKNDIVFANRPSLMVGKHMGCNFTSLAWAPYGDHWRNLRRVASLEILSSSRLQLLSNIRADEVKSLVRRLFHNQLIESVDLRMEIYDLTMNVMMRMIAGK 646
            S+ +   +FL L+ L K +  K   +LPP P+  LPIIG+L+ L        + L  L +++GP++ L+ G    LVVSSP  A E    +D+ F  RP L+  + M    T +A+APYGD+WR +R++ +LE+LS+ R+Q  S+IR DE K L++ + H+     +DL  +++ L    + R   GK
Sbjct:    7 SIVITFFVFLLLHWLVKTYKQKSSHKLPPGPW-RLPIIGNLHQLALAASLPDQALQKLVRKYGPLMHLQLGEISTLVVSSPKMAMEMMKTHDVHFVQRPQLLAPQFMVYGATDIAFAPYGDYWRQIRKICTLELLSAKRVQSFSHIRQDENKKLIQSI-HSSAGSPIDLSGKLFSLLGTTVSRAAFGK 192          
The following BLAST results are available for this feature:
BLAST of FC876209 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 135
Match NameE-valueIdentityDescription
C81E1_GLYEC1.297e-4246.11Isoflavone 2'-hydroxylase OS=Glycyrrhiza echinata ... [more]
C81D1_ARATH3.772e-4249.75Cytochrome P450 81D1 OS=Arabidopsis thaliana GN=CY... [more]
C81F1_ARATH3.305e-3845.96Cytochrome P450 81F1 OS=Arabidopsis thaliana GN=CY... [more]
C75A1_PINTA1.942e-3036.11Cytochrome P450 750A1 OS=Pinus taeda GN=CYP750A1 P... [more]
C82A1_PEA1.178e-2736.32Cytochrome P450 82A1 (Fragment) OS=Pisum sativum G... [more]
C71BM_ARATH5.847e-2735.45Cytochrome P450 71B22 OS=Arabidopsis thaliana GN=C... [more]
C71BL_ARATH5.847e-2735.68Cytochrome P450 71B21 OS=Arabidopsis thaliana GN=C... [more]
C71AG_ARATH5.847e-2736.32Cytochrome P450 71A16 OS=Arabidopsis thaliana GN=C... [more]
C71A6_NEPRA4.950e-2637.99Cytochrome P450 71A6 (Fragment) OS=Nepeta racemosa... [more]
C71D8_SOYBN8.443e-2636.17Cytochrome P450 71D8 OS=Glycine max GN=CYP71D8 PE=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001G02EF DevOvary1 Citrus clementina cDNA clone C32001G02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876209 ID=FC876209|Name=FC876209|organism=Citrus clementina|type=EST|length=667bp
GGAAAAAGGAGTGAGGCAATGCCCCCGATCTGAATTAAAGGTTCTCTCTC
ATGTTTCTTGGGCATAGCTAGCAGCCATACATACATCAATGAAGAGCTTG
GCTCTCTACTTGCCCATATTTCTGGCACTGTATGTCCTCACAAAGCAATT
TTTAAACAAAATCAGACGCCTCCCACCAAGTCCATTTCTTGAGCTACCCA
TAATTGGACATCTCTACCTCCTCAAGCGACCAATTCATAGAACACTATCC
AATTTATCAAAACGACACGGTCCCATTCTCCTCCTCCGATTCGGTTCTCG
CCGTGTCCTTGTTGTCTCATCACCACCAGCAGCCGAAGAATGCTTCACTA
AAAACGACATCGTCTTCGCCAACCGCCCTTCCTTGATGGTCGGCAAACAC
ATGGGTTGCAACTTCACGAGCCTCGCCTGGGCCCCATACGGCGACCACTG
GAGAAACCTTAGACGAGTCGCCTCGCTCGAAATTCTGTCCTCTTCTCGCC
TCCAACTCTTATCTAATATTCGCGCTGATGAGGTCAAATCTTTGGTCCGC
CGTCTCTTTCACAATCAATTGATCGAATCCGTTGACTTGAGGATGGAGAT
TTATGATCTCACAATGAATGTCATGATGAGGATGATCGCTGGAAAGAGAT
ATTACGGCAAACACGTG
back to top