FC876213

Overview
NameFC876213
Unique NameFC876213
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length705
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10314 contig Ccv1_Contig10314:1..705. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876213 vs. ExPASy Swiss-Prot
Match: B3GTH_ARATH (Probable beta-1,3-galactosyltransferase 17 OS=Arabidopsis thaliana GN=B3GALT17 PE=2 SV=2)

HSP 1 Score: 101.293 bits (251), Expect = 5.366e-21
Identity = 61/155 (39.35%), Postives = 91/155 (58.71%), Query Frame = 1
Query:  256 MKRAKLESVLPLSRLRLIQFLMGILFLYLLFMSFEIPFVFKSDTG------SVGFFADTLPKHVLLENEAEELYTASRPSKDTSASTYQTFS-------RAPERRMREFKRVSGLFFNESALDDSESNIDEFSVLHKIAKDAWSVGKEVWDELES 681
            MK++KL++     R  L+QFL+ +L  Y L MSFEIPF+F++ +G      S   FAD LP+ +++   + E        ++  A  ++ F        R PER+MREFK VS +F NES  D+   + DEFS+ HK AK A S+G+++WD L+S
Sbjct:    1 MKKSKLDNSSSQIRFGLVQFLLVVLLFYFLCMSFEIPFIFRTGSGSGSDDVSSSSFADALPRPMVVGGGSREANWV--VGEEEEADPHRHFKDPGRVQLRLPERKMREFKSVSEIFVNESFFDNGGFS-DEFSIFHKTAKHAISMGRKMWDGLDS 152          
BLAST of FC876213 vs. ExPASy Swiss-Prot
Match: B3GTJ_ARATH (Probable beta-1,3-galactosyltransferase 19 OS=Arabidopsis thaliana GN=B3GALT19 PE=2 SV=2)

HSP 1 Score: 77.7962 bits (190), Expect = 6.354e-14
Identity = 50/141 (35.46%), Postives = 77/141 (54.61%), Query Frame = 1
Query:  268 KLESVLPLSRLRLIQFLMGILFLYLLFMSFEIPFVFKSDTGSVGFFADTLPKHVLLENEAEELYTASRPSKDTSASTYQTFSRAPERRMREFKRV-SGLFFNESALDDSESNIDEFSVLHKIAKDAWSVGKEVWDELESAE 687
            K +  + LS+ R +Q LM +  LY+L ++FEIPFVFK+   S+     T P+    + E +E    +RP K  S    ++ S +P + +R   R+ S L F+    + S    D    LHK AK AW VG+++W+ELES +
Sbjct:   14 KFDIFVSLSKQRSVQILMAVGLLYMLLITFEIPFVFKTGLSSLSQDPLTRPEKHNSQRELQERRAPTRPLK--SLLYQESQSESPAQGLRRRTRILSSLRFDPETFNPSSK--DGSVELHKSAKVAWEVGRKIWEELESGK 150          
The following BLAST results are available for this feature:
BLAST of FC876213 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
B3GTH_ARATH5.366e-2139.35Probable beta-1,3-galactosyltransferase 17 OS=Arab... [more]
B3GTJ_ARATH6.354e-1435.46Probable beta-1,3-galactosyltransferase 19 OS=Arab... [more]
back to top
Properties
Property NameValue
Genbank descriptionC32001G07EF DevOvary1 Citrus clementina cDNA clone C32001G07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876213 ID=FC876213|Name=FC876213|organism=Citrus clementina|type=EST|length=705bp
GGAGAAGAGAAATTGTTTCCCATCCAGTATGAGATTTTGCTTTGCTTGAC
CCTTTAAAGTTTTTGTTCTAATAATTTTATAGAATTTGATCGTAATTAAT
TCAAAACATCTTCTCCCCTTTCTCTGAGTTAAGTTAGTGTCTCTTGCTGC
TATTGTGTGATTGTGAACGCGCCTTGGTTCTGAGTGCTAGCTTCTCAAAA
TAAACCAAATACAAAGATCAAGTTAGACTTTTGTTTTCTGTTATTTGGTT
TTACAATGAAGCGAGCGAAGCTGGAGTCGGTGTTGCCACTGAGTCGACTC
AGACTGATTCAATTCTTGATGGGTATCCTGTTTCTTTACCTTCTCTTCAT
GAGCTTTGAAATCCCTTTTGTATTTAAATCCGACACCGGGTCTGTTGGGT
TCTTCGCCGACACTTTGCCCAAGCATGTGCTGCTCGAAAACGAAGCGGAA
GAGCTGTACACAGCGAGTCGACCTTCAAAGGACACGTCAGCCTCCACCTA
TCAGACATTTTCTCGTGCGCCTGAGCGGCGAATGCGCGAGTTCAAGAGAG
TCTCAGGTTTGTTCTTCAACGAGAGTGCGCTCGATGACAGCGAAAGTAAC
ATAGATGAGTTCTCGGTTCTTCACAAGATCGCGAAGGACGCGTGGTCTGT
CGGCAAAGAAGTCTGGGATGAGCTCGAATCGGCGGAGAACTATAGCAAAA
CCCAA
back to top