FC876214

Overview
NameFC876214
Unique NameFC876214
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length725
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60C_ARATH (Chaperonin CPN60-like 2, mitochondrial OS=Arabidopsis thaliana GN=At3g13860 PE=1 SV=2)

HSP 1 Score: 381.719 bits (979), Expect = 2.132e-105
Identity = 197/241 (81.74%), Postives = 214/241 (88.80%), Query Frame = 3
Query:    3 ASSISSPRCKKGVYGRVLCNRNYVAKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENPL 725
            +SSI S   +K V GR++ +RNY AKDI+FG+GARAAMLQGVSEVAEAVKVTMGPKGRNVIIE S G PK+TKDGVTVA SI F+ KAK++GA LVKQVA ATNK AGDGTTCATVLTQAIL EGCKSVAAG+NVMDLR GI MAI AV+SDLKSRA MISTPEEITQVATISANGEREIGEL+ARAMEKVGKEGVITV DGNT+ NELE V GMKLARGYISPYF+TD KTQKCELENP+
Sbjct:    9 SSSIGSSTSRKLVSGRIISSRNYAAKDISFGIGARAAMLQGVSEVAEAVKVTMGPKGRNVIIESSYGGPKITKDGVTVAKSISFQAKAKNIGAELVKQVASATNKVAGDGTTCATVLTQAILIEGCKSVAAGVNVMDLRVGINMAIAAVVSDLKSRAVMISTPEEITQVATISANGEREIGELIARAMEKVGKEGVITVADGNTLDNELEVVEGMKLARGYISPYFITDEKTQKCELENPI 249          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH61_MAIZE (Chaperonin CPN60-1, mitochondrial OS=Zea mays GN=CPN60I PE=1 SV=2)

HSP 1 Score: 343.199 bits (879), Expect = 8.405e-94
Identity = 173/229 (75.55%), Postives = 198/229 (86.46%), Query Frame = 3
Query:   39 VYGRVLCNRNYVAKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENPL 725
            V  R+  +RNY AKDI FGV ARA ML+GV E+A+AVKVTMGPKGRNV+IE+S G PKVTKDGVTVA SIEF+D+ K+VGA+LVKQVA ATN  AGDGTTCATVLT+AI TEGCKSVAAG+N MDLR GI MA+DAV+++LK  A+MIST EEI QV TISANGEREIGEL+A+AMEKVGKEGVIT+ DGNT+ NELE V GMKL RGYISPYF+T+ KTQKCELE+PL
Sbjct:   24 VGSRLAWSRNYAAKDIKFGVEARALMLRGVEELADAVKVTMGPKGRNVVIEQSFGAPKVTKDGVTVAKSIEFKDRVKNVGASLVKQVANATNDTAGDGTTCATVLTKAIFTEGCKSVAAGMNAMDLRRGISMAVDAVVTNLKGMARMISTSEEIAQVGTISANGEREIGELIAKAMEKVGKEGVITIADGNTLYNELEVVEGMKLDRGYISPYFITNSKTQKCELEDPL 252          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH62_MAIZE (Chaperonin CPN60-2, mitochondrial OS=Zea mays GN=CPN60II PE=2 SV=1)

HSP 1 Score: 342.428 bits (877), Expect = 1.434e-93
Identity = 174/241 (72.20%), Postives = 200/241 (82.99%), Query Frame = 3
Query:    3 ASSISSPRCKKGVYGRVLCNRNYVAKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENPL 725
            A    S    + V  R+  +RNY AKDI FGV ARA ML+GV E+A+AVKVTMGPKGRNV+IE+S G PKVTKDGVTVA SIEF+D+ K+VGA+LVKQVA ATN  AGDGTTCATVLT+AI TEGCKSVAAG+N MDLR GI MA+DAV+++LK  A+MIST EEI QV TISANGEREIGEL+A+AMEKVGKEGVIT+ DGNT+ NELE V GMKL RGYISPYF+T+ K QKCELE+PL
Sbjct:   12 ARQAGSSSAARQVGSRLAWSRNYAAKDIKFGVEARALMLRGVEELADAVKVTMGPKGRNVVIEQSFGAPKVTKDGVTVAKSIEFKDRVKNVGASLVKQVANATNDTAGDGTTCATVLTKAIFTEGCKSVAAGMNAMDLRRGISMAVDAVVTNLKGMARMISTSEEIAQVGTISANGEREIGELIAKAMEKVGKEGVITIADGNTLYNELEVVEGMKLDRGYISPYFITNSKAQKCELEDPL 252          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60B_ARATH (Chaperonin CPN60-like 1, mitochondrial OS=Arabidopsis thaliana GN=At2g33210 PE=1 SV=1)

HSP 1 Score: 340.502 bits (872), Expect = 5.448e-93
Identity = 170/234 (72.65%), Postives = 200/234 (85.47%), Query Frame = 3
Query:   24 RCKKGVYGRVLCNRNYVAKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENPL 725
            +C   +  R+   RNY AKDI FGV ARA ML+GV ++A+AVKVTMGPKGRNVIIE+S G PKVTKDGVTVA SIEF+D+ K+VGA+LVKQVA ATN  AGDGTTCATVLT+AI TEGCKSVAAG+N MDLR GIK+A+D V+++L+SRA+MIST EEI QV TISANG+REIGEL+A+AME VGKEGVIT+ DG T+ NELE V GMK+ RGYISPYF+T+PKTQKCELE+PL
Sbjct:   17 KCTSQIGSRLNSTRNYAAKDIRFGVEARALMLRGVEDLADAVKVTMGPKGRNVIIEQSWGAPKVTKDGVTVAKSIEFKDRIKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFTEGCKSVAAGMNAMDLRRGIKLAVDTVVTNLQSRARMISTSEEIAQVGTISANGDREIGELIAKAMETVGKEGVITIQDGKTLFNELEVVEGMKIDRGYISPYFITNPKTQKCELEDPL 250          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH62_CUCMA (Chaperonin CPN60-2, mitochondrial OS=Cucurbita maxima GN=CPN60-2 PE=1 SV=1)

HSP 1 Score: 335.88 bits (860), Expect = 1.342e-91
Identity = 166/222 (74.77%), Postives = 194/222 (87.39%), Query Frame = 3
Query:   60 NRNYVAKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENPL 725
            +RNY AKD+ FGV AR  ML+GV ++A+AVKVTMGPKGRNV+IE+S G PKVTKDGVTVA SIEF+DK K+VGA+LVKQVA ATN  AGDGTTCAT+LT+AI TEGCKSVAAG+N MDLR GI MA+D+V+++LKSRA+MIST EEI QV TISANGEREIGEL+A+AMEKVGKEGVIT+ DG T+ NELE V GMKL RGYISPYF+T+ K QKCEL++PL
Sbjct:   29 SRNYAAKDVKFGVEARGLMLKGVEDLADAVKVTMGPKGRNVVIEQSYGAPKVTKDGVTVAKSIEFKDKVKNVGASLVKQVANATNDVAGDGTTCATILTRAIFTEGCKSVAAGMNAMDLRRGISMAVDSVVTNLKSRARMISTSEEIAQVGTISANGEREIGELIAKAMEKVGKEGVITISDGKTLFNELEVVEGMKLDRGYISPYFITNQKNQKCELDDPL 250          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60A_ARATH (Chaperonin CPN60, mitochondrial OS=Arabidopsis thaliana GN=CPN60 PE=1 SV=2)

HSP 1 Score: 335.109 bits (858), Expect = 2.289e-91
Identity = 169/229 (73.80%), Postives = 197/229 (86.03%), Query Frame = 3
Query:   39 VYGRVLCNRNYVAKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENPL 725
            V  R+  +RNY AK+I FGV ARA ML+GV ++A+AVKVTMGPKGRNV+IE+S G PKVTKDGVTVA SIEF+DK K+VGA+LVKQVA ATN  AGDGTTCATVLT+AI  EGCKSVAAG+N MDLR GI MA+DAV+++LKS+A+MIST EEI QV TISANGEREIGEL+A+AMEKVGKEGVIT+ DG T+ NELE V GMKL RGY SPYF+T+ KTQKCEL++PL
Sbjct:   21 VSSRMSWSRNYAAKEIKFGVEARALMLKGVEDLADAVKVTMGPKGRNVVIEQSWGAPKVTKDGVTVAKSIEFKDKIKNVGASLVKQVANATNDVAGDGTTCATVLTRAIFAEGCKSVAAGMNAMDLRRGISMAVDAVVTNLKSKARMISTSEEIAQVGTISANGEREIGELIAKAMEKVGKEGVITIQDGKTLFNELEVVEGMKLDRGYTSPYFITNQKTQKCELDDPL 249          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH61_CUCMA (Chaperonin CPN60-1, mitochondrial OS=Cucurbita maxima GN=CPN60-1 PE=1 SV=1)

HSP 1 Score: 332.413 bits (851), Expect = 1.484e-90
Identity = 165/221 (74.66%), Postives = 192/221 (86.88%), Query Frame = 3
Query:   63 RNYVAKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENPL 725
            RNY AKD+ FGV AR  ML+GV ++A+AVKVTMGPKGR V+IE+S G PKVTKDGVTVA SIEF+DK K+VGA+LVKQVA ATN  AGDGTTCAT+LT+AI TEGCKSVA+G+N MDLR GI MA+D+V+++LKSRA+MIST EEI QV TISANGEREIGEL+A+AMEKVGKEGVIT+ DG TM NELE V GMKL RGYISPYF+T+ K QKCEL++PL
Sbjct:   30 RNYAAKDVKFGVEARGLMLKGVEDLADAVKVTMGPKGRTVVIEQSFGAPKVTKDGVTVAKSIEFKDKVKNVGASLVKQVANATNDVAGDGTTCATILTKAIFTEGCKSVASGMNAMDLRRGISMAVDSVVTNLKSRARMISTSEEIAQVGTISANGEREIGELIAKAMEKVGKEGVITISDGKTMDNELEVVEGMKLDRGYISPYFITNQKNQKCELDDPL 250          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_BRANA (Chaperonin CPN60, mitochondrial OS=Brassica napus PE=2 SV=1)

HSP 1 Score: 305.064 bits (780), Expect = 2.536e-82
Identity = 159/236 (67.37%), Postives = 187/236 (79.24%), Query Frame = 3
Query:   27 CKKGVYGRVLCNRNYVAKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAG---ATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENPL 725
            C   +  R+   RNY AKDI FGV  RA ML+GV E+A+AVKVT+ PKGRNVIIE+S G PKVTKDGVTVA SIEF+D+ K+VGA+LVKQVA      N+  GDGTTCATVLT+AI TEGCKSVAAG+N MDLR GIK+A+D V++ LKSRA+MIST EEI QV TISANG+RE+     +AME VGKEGVIT+ DG T+ NELE V GMK+ RGYISPYF+T+ K QKCELE+PL
Sbjct:   18 CTSQIGSRLSSTRNYAAKDIRFGVEGRALMLRGVEELADAVKVTIPPKGRNVIIEQSWGAPKVTKDGVTVAKSIEFKDRVKNVGASLVKQVANRPTQLNRCLGDGTTCATVLTRAIFTEGCKSVAAGMNAMDLRRGIKLAVDTVVTKLKSRARMISTSEEIAQVGTISANGDREL-VTDCKAMESVGKEGVITIQDGKTLFNELEVVEGMKIDRGYISPYFITNQKNQKCELEDPL 252          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: HSP60_SCHPO (Heat shock protein 60, mitochondrial OS=Schizosaccharomyces pombe GN=hsp60 PE=1 SV=1)

HSP 1 Score: 265.774 bits (678), Expect = 1.705e-70
Identity = 134/217 (61.75%), Postives = 172/217 (79.26%), Query Frame = 3
Query:   75 AKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENPL 725
            AKD+ FGV ARA++L GV  +A AV VT+GPKGRNV+I++  G+PK+TKDGVTVA S+  +DK +++GA LV+ VA  TN+ AGDGTT ATVLT+AI +E  ++VAAG N MDLR GI++A+D V+  L++  + I+T EEI+QVATISANG+  IGELLA+AME+VGKEGVITV +G T+ +ELE   GMK  RGYISPYF+TD K+QK E ENPL
Sbjct:   34 AKDLKFGVDARASLLTGVDTLARAVSVTLGPKGRNVLIDQPFGSPKITKDGVTVARSVSLKDKFENLGARLVQDVASKTNEVAGDGTTTATVLTRAIFSETVRNVAAGCNPMDLRRGIQLAVDNVVEFLQANKRDITTSEEISQVATISANGDTHIGELLAKAMERVGKEGVITVKEGRTISDELEVTEGMKFDRGYISPYFITDVKSQKVEFENPL 250          
BLAST of FC876214 vs. ExPASy Swiss-Prot
Match: CH60_DICDI (60 kDa heat shock protein, mitochondrial OS=Dictyostelium discoideum GN=hspA PE=2 SV=1)

HSP 1 Score: 259.61 bits (662), Expect = 1.222e-68
Identity = 130/222 (58.56%), Postives = 170/222 (76.58%), Query Frame = 3
Query:   63 RNY-VAKDINFGVGARAAMLQGVSEVAEAVKVTMGPKGRNVIIEKSVGNPKVTKDGVTVASSIEFRDKAKDVGANLVKQVAGATNKAAGDGTTCATVLTQAILTEGCKSVAAGLNVMDLRSGIKMAIDAVISDLKSRAQMISTPEEITQVATISANGEREIGELLARAMEKVGKEGVITVVDGNTMVNELESVGGMKLARGYISPYFVTDPKTQKCELENPL 725
            RNY   KDI FG   RA ML+GV ++A AV+VT+GPKGRNVI+++  G PK+TKDGVTVA  IEF D+  ++GA LVK VA + N  +GDGTT AT+LT+AI  EGCK+VAAG+N MDL  GI  A++ V+ +LK+ ++ IS+ EEI+QVATISANG++ IG L+A AMEK+GKEGVITV DG T+ +ELE + GMK  +G+IS YF+ D K QKCE ++P+
Sbjct:   15 RNYSTGKDIKFGAECRALMLRGVEQLAAAVEVTLGPKGRNVILDQPFGQPKITKDGVTVAKHIEFADRHINLGAQLVKGVASSQNDQSGDGTTTATILTRAIFAEGCKAVAAGMNPMDLWRGINFAVEKVVGELKTISRPISSTEEISQVATISANGDKVIGNLIANAMEKIGKEGVITVQDGKTLKDELEIIEGMKFDQGFISRYFINDAKEQKCEFDDPV 236          
The following BLAST results are available for this feature:
BLAST of FC876214 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CH60C_ARATH2.132e-10581.74Chaperonin CPN60-like 2, mitochondrial OS=Arabidop... [more]
CH61_MAIZE8.405e-9475.55Chaperonin CPN60-1, mitochondrial OS=Zea mays GN=C... [more]
CH62_MAIZE1.434e-9372.20Chaperonin CPN60-2, mitochondrial OS=Zea mays GN=C... [more]
CH60B_ARATH5.448e-9372.65Chaperonin CPN60-like 1, mitochondrial OS=Arabidop... [more]
CH62_CUCMA1.342e-9174.77Chaperonin CPN60-2, mitochondrial OS=Cucurbita max... [more]
CH60A_ARATH2.289e-9173.80Chaperonin CPN60, mitochondrial OS=Arabidopsis tha... [more]
CH61_CUCMA1.484e-9074.66Chaperonin CPN60-1, mitochondrial OS=Cucurbita max... [more]
CH60_BRANA2.536e-8267.37Chaperonin CPN60, mitochondrial OS=Brassica napus ... [more]
HSP60_SCHPO1.705e-7061.75Heat shock protein 60, mitochondrial OS=Schizosacc... [more]
CH60_DICDI1.222e-6858.5660 kDa heat shock protein, mitochondrial OS=Dictyo... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001G09EF DevOvary1 Citrus clementina cDNA clone C32001G09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876214 ID=FC876214|Name=FC876214|organism=Citrus clementina|type=EST|length=725bp
GAGCCTCTTCAATCAGTTCCCCTCGCTGCAAGAAAGGGGTGTATGGTAGG
GTTTTATGCAATAGGAACTATGTGGCGAAGGATATCAATTTTGGAGTTGG
TGCACGAGCTGCCATGTTACAAGGTGTATCCGAGGTGGCAGAAGCTGTAA
AAGTTACCATGGGACCAAAGGGTCGCAATGTGATTATTGAGAAAAGTGTT
GGAAATCCCAAGGTCACAAAGGATGGTGTTACTGTTGCCAGCAGCATAGA
ATTCAGGGACAAGGCAAAAGATGTTGGTGCAAACCTTGTAAAGCAGGTTG
CCGGTGCTACTAATAAAGCTGCGGGAGATGGTACAACTTGCGCAACTGTT
CTGACTCAGGCCATTCTCACAGAAGGCTGTAAATCTGTAGCTGCTGGTCT
AAATGTGATGGATTTGCGCAGTGGTATTAAGATGGCGATCGATGCAGTCA
TATCTGATTTAAAAAGCAGAGCACAAATGATTAGTACACCGGAAGAAATT
ACACAGGTGGCGACTATCTCTGCAAATGGTGAACGGGAGATTGGGGAACT
GCTAGCAAGAGCAATGGAGAAAGTTGGAAAGGAAGGAGTCATTACTGTTG
TTGATGGAAATACTATGGTTAATGAGCTGGAAAGTGTTGGAGGAATGAAG
CTAGCCAGAGGTTACATTTCTCCTTATTTTGTTACAGATCCAAAGACACA
GAAATGTGAACTTGAAAATCCTCTG
back to top