FC876225

Overview
NameFC876225
Unique NameFC876225
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length643
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10315 contig Ccv1_Contig10315:1..643. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876225 vs. ExPASy Swiss-Prot
Match: DR102_ARATH (DNA-damage-repair/toleration protein DRT102 OS=Arabidopsis thaliana GN=DRT102 PE=2 SV=2)

HSP 1 Score: 229.18 bits (583), Expect = 1.433e-59
Identity = 114/173 (65.90%), Postives = 134/173 (77.46%), Query Frame = 1
Query:  100 ADAAAPHPLKIIAGADSFGAELKDALVSHLRSLNIDVEDLGTSDYYSIGAEVGRRVSSSDSSETTTRGLVACGTGVGVAIFANKNPGVFATTCLTPADALNTRSINNCNVLAVSGMSTSKESAVEILDTWLKTPFKAPCPASGLKPWDEKLSCFFDKSMTEMPLIGKNDKLDS 618
            A +A   PLKII GAD FGA LKDA+V+HLRSL IDVED G S YYS G+EVGRRVS+S SSE   RGLV CGTGVGVA+FANK PGV+A TCL+  DA+N RSI+NCNVLA SG+ TS E+A+EI D W+KTPFK+PCPASG +PW   +S F D S++EM  IGK+   DS
Sbjct:    4 AVSAVDQPLKIITGADDFGASLKDAMVTHLRSLGIDVEDTGVSSYYSAGSEVGRRVSASSSSEV--RGLVCCGTGVGVAMFANKFPGVYAATCLSVEDAVNARSISNCNVLAFSGIKTSPETALEIFDAWIKTPFKSPCPASGSEPWSSVISSFLDNSLSEMSQIGKSTAGDS 174          
BLAST of FC876225 vs. ExPASy Swiss-Prot
Match: RPIB_ECOLI (Ribose-5-phosphate isomerase B OS=Escherichia coli (strain K12) GN=rpiB PE=1 SV=2)

HSP 1 Score: 72.7886 bits (177), Expect = 1.716e-12
Identity = 46/132 (34.85%), Postives = 65/132 (49.24%), Query Frame = 1
Query:  127 KIIAGADSFGAELKDALVSHLRSLNIDVEDLGT-----SDYYSIGAEVGRRVSSSDSSETTTRGLVACGTGVGVAIFANKNPGVFATTCLTPADALNTRSINNCNVLAVSGMSTSKESAVEILDTWLKTPFK 507
            KI  G D  G  LK  +V+HL    ++V D GT     +DY    ++V   V+  +       G++ CGTGVG++I ANK  G+ A  C  P  A  +R  N+ NVLA        E A  I+D WL   ++
Sbjct:    3 KIAFGCDHVGFILKHEIVAHLVERGVEVIDKGTWSSERTDYPHYASQVALAVAGGE----VDGGILICGTGVGISIAANKFAGIRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVGLELAKMIVDAWLGAQYE 130          
BLAST of FC876225 vs. ExPASy Swiss-Prot
Match: LACB_STRMU (Galactose-6-phosphate isomerase subunit lacB OS=Streptococcus mutans GN=lacB PE=3 SV=2)

HSP 1 Score: 67.781 bits (164), Expect = 5.520e-11
Identity = 41/129 (31.78%), Postives = 64/129 (49.61%), Query Frame = 1
Query:  124 LKIIAGADSFGAELKDALVSHLRSLNIDVEDLGTSDYYSIGAEV-GRRVSSSDSSETTTRGLVACGTGVGVAIFANKNPGVFATTCLTPADALNTRSINNCNVLAVSGMSTSKESAVEILDTWLKTPFK 507
            +KI  G D    ++K  L  HL+    +V D+GT D+      + G++V  + SS     G+  CGTGVG++  ANK PGV          AL ++   N NV++  G    K    +I+D ++K  +K
Sbjct:    1 MKIAIGCDHIVTDVKMELSKHLKEEGYEVLDVGTYDFTRTHYPIFGKKVGEAVSSGEADLGVCMCGTGVGISNAANKVPGVRTALVRDMTSALYSKEELNANVVSFGGAIIGKLLLFDIVDAFIKAQYK 129          
The following BLAST results are available for this feature:
BLAST of FC876225 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
DR102_ARATH1.433e-5965.90DNA-damage-repair/toleration protein DRT102 OS=Ara... [more]
RPIB_ECOLI1.716e-1234.85Ribose-5-phosphate isomerase B OS=Escherichia coli... [more]
LACB_STRMU5.520e-1131.78Galactose-6-phosphate isomerase subunit lacB OS=St... [more]
back to top
Properties
Property NameValue
Genbank descriptionC32002A04EF DevOvary1 Citrus clementina cDNA clone C32002A04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876225 ID=FC876225|Name=FC876225|organism=Citrus clementina|type=EST|length=643bp
GTCATCCACCCAGAAAGTAGACTCAGTAACTGGCTCTCCACTGAACTCAT
CCGGTCATCCCTCAGAATAGTCAACTCATAGTCAACCATGGCTGAAAACG
CTGACGCCGCTGCTCCTCACCCTCTCAAAATCATCGCCGGCGCCGACTCC
TTTGGTGCTGAATTGAAAGACGCTTTGGTCTCCCACCTTCGGTCACTCAA
CATAGACGTGGAAGATCTCGGCACTTCTGATTACTACTCCATCGGCGCCG
AGGTCGGCCGCCGTGTCTCCTCTTCCGATTCCTCCGAAACCACCACTCGC
GGCCTCGTCGCCTGCGGAACCGGAGTCGGCGTCGCAATCTTCGCCAACAA
AAACCCCGGCGTCTTCGCCACGACGTGTCTCACTCCCGCCGACGCCCTCA
ACACCCGCTCCATCAACAACTGCAACGTCCTCGCTGTCTCAGGTATGTCC
ACTTCCAAAGAATCCGCCGTCGAAATCCTCGACACGTGGCTTAAAACCCC
TTTTAAGGCCCCATGCCCCGCGTCGGGTTTGAAGCCATGGGATGAGAAAT
TGTCGTGTTTTTTCGACAAGTCGATGACCGAAATGCCCCTTATTGGTAAA
AATGATAAATTAGATAGTGATTCTAGTGGCAGCACTTGTAGCA
back to top