FC876226

Overview
NameFC876226
Unique NameFC876226
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length522
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC876226_ssr13 microsatellite FC876226_ssr13:13..32. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig14141 contig Ccv1_Contig14141:9..530. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876226 vs. ExPASy Swiss-Prot
Match: EXPA3_ARATH (Expansin-A3 OS=Arabidopsis thaliana GN=EXPA3 PE=2 SV=1)

HSP 1 Score: 272.322 bits (695), Expect = 9.521e-73
Identity = 123/151 (81.46%), Postives = 135/151 (89.40%), Query Frame = 1
Query:   73 FRMLCFFSVALSLFATA-NAKIPGVFAGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFELKCGGDPQWCNPGNPAILITATNFCPPNFAQPSDNGGWCNPPRPHFDLAMPMFLKLAQYRAGIVPV 522
            FR+  + +V  S   TA NAKIPGV++GGPWQ+AHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNG SCGACFE+KC  DP+WC PGNP+IL+TATNFCPPNFAQPSD+GGWCNPPR HFDLAMPMFLK+  YRAGIVPV
Sbjct:    6 FRVGLWLAVTASFLLTATNAKIPGVYSGGPWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGFSCGACFEIKCTDDPRWCVPGNPSILVTATNFCPPNFAQPSDDGGWCNPPREHFDLAMPMFLKIGLYRAGIVPV 156          
BLAST of FC876226 vs. ExPASy Swiss-Prot
Match: EXPA6_ARATH (Expansin-A6 OS=Arabidopsis thaliana GN=EXPA6 PE=2 SV=2)

HSP 1 Score: 268.855 bits (686), Expect = 1.053e-71
Identity = 118/143 (82.52%), Postives = 131/143 (91.61%), Query Frame = 1
Query:   94 SVALSLFATANAKIPGVFAGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFELKCGGDPQWCNPGNPAILITATNFCPPNFAQPSDNGGWCNPPRPHFDLAMPMFLKLAQYRAGIVPV 522
            SV  ++ A + A+IPGV+ GG W++AHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNG SCGACFELKC  DP+WC+ G+P+I ITATNFCPPNFAQPSDNGGWCNPPRPHFDLAMPMFLK+A+YRAGIVPV
Sbjct:    9 SVLTTILALSEARIPGVYNGGGWETAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGFSCGACFELKCASDPKWCHSGSPSIFITATNFCPPNFAQPSDNGGWCNPPRPHFDLAMPMFLKIAEYRAGIVPV 151          
BLAST of FC876226 vs. ExPASy Swiss-Prot
Match: EXPA4_ARATH (Expansin-A4 OS=Arabidopsis thaliana GN=EXPA4 PE=1 SV=1)

HSP 1 Score: 268.47 bits (685), Expect = 1.375e-71
Identity = 117/138 (84.78%), Postives = 130/138 (94.20%), Query Frame = 1
Query:  109 LFATANAKIPGVFAGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFELKCGGDPQWCNPGNPAILITATNFCPPNFAQPSDNGGWCNPPRPHFDLAMPMFLKLAQYRAGIVPV 522
            LF+ A+A+IPG+++GG WQ+AHATFYGGSDASGTMGGACGYGNLYSQGYG NTAALSTALFNNG+SCGACFELKC  DPQWC+ G+P+ILITATNFCPPN AQPSDNGGWCNPPR HFDLAMP+FLK+AQYRAGIVPV
Sbjct:   14 LFSLADARIPGIYSGGAWQNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGMSCGACFELKCANDPQWCHSGSPSILITATNFCPPNLAQPSDNGGWCNPPREHFDLAMPVFLKIAQYRAGIVPV 151          
BLAST of FC876226 vs. ExPASy Swiss-Prot
Match: EXPA9_ARATH (Expansin-A9 OS=Arabidopsis thaliana GN=EXPA9 PE=2 SV=1)

HSP 1 Score: 262.692 bits (670), Expect = 7.544e-70
Identity = 118/149 (79.19%), Postives = 131/149 (87.92%), Query Frame = 1
Query:   76 RMLCFFSVALSLFATANAKIPGVFAGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFELKCGGDPQWCNPGNPAILITATNFCPPNFAQPSDNGGWCNPPRPHFDLAMPMFLKLAQYRAGIVPV 522
            +++ F +V +    TANAKIPGV+ GGPW +AHATFYG +DASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCG+CFELKC  DP WC PGNP+ILITATNFCPPNF Q SDNGGWCNPPR HFDLAMPMFL +A+Y+AGIVPV
Sbjct:    4 KVITFMAVMVVTAFTANAKIPGVYTGGPWINAHATFYGEADASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGSCFELKCINDPGWCLPGNPSILITATNFCPPNFNQASDNGGWCNPPREHFDLAMPMFLSIAKYKAGIVPV 152          
BLAST of FC876226 vs. ExPASy Swiss-Prot
Match: EXP16_ARATH (Expansin-A16 OS=Arabidopsis thaliana GN=EXPA16 PE=2 SV=1)

HSP 1 Score: 253.447 bits (646), Expect = 4.577e-67
Identity = 112/148 (75.68%), Postives = 130/148 (87.84%), Query Frame = 1
Query:   79 MLCFFSVALSLFATANAKIPGVFAGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFELKCGGDPQWCNPGNPAILITATNFCPPNFAQPSDNGGWCNPPRPHFDLAMPMFLKLAQYRAGIVPV 522
            +L  F + L L  T +A IP VF+GG WQ+AHATFYGG+DASGTMGGACGYGNLYSQGYG NTAALST+LFN+G SCGACFE+KC  DP+WC+PGNP++ +TATNFCPPN AQPSDNGGWCNPPR HFDLAMP+FLK+A+YRAGIVP+
Sbjct:    8 LLTIFPLFLLLSFT-DAGIPRVFSGGSWQTAHATFYGGNDASGTMGGACGYGNLYSQGYGTNTAALSTSLFNSGQSCGACFEIKCVNDPKWCHPGNPSVFVTATNFCPPNLAQPSDNGGWCNPPRSHFDLAMPVFLKIAEYRAGIVPI 154          
BLAST of FC876226 vs. ExPASy Swiss-Prot
Match: EXPA7_ORYSJ (Expansin-A7 OS=Oryza sativa subsp. japonica GN=EXPA7 PE=2 SV=1)

HSP 1 Score: 250.366 bits (638), Expect = 3.875e-66
Identity = 114/144 (79.17%), Postives = 127/144 (88.19%), Query Frame = 1
Query:   97 VALSLFATANAKIPGVFAGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFELKCGGDP--QWCNPGNPAILITATNFCPPNFAQPSDNGGWCNPPRPHFDLAMPMFLKLAQYRAGIVPV 522
            VAL + + A  +IPG + GG WQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVN AALSTALFN+G SCGACFE+KC   P  +WC+PG+P+ILITATNFCPPN+A PSDNGGWCNPPRPHFDLAMPMFL +A+YRAGIVPV
Sbjct:   16 VALQV-SPAAGRIPGAYGGGEWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNNAALSTALFNSGQSCGACFEIKCVNQPGWEWCHPGSPSILITATNFCPPNYALPSDNGGWCNPPRPHFDLAMPMFLHIAEYRAGIVPV 158          
BLAST of FC876226 vs. ExPASy Swiss-Prot
Match: EXPA1_ARATH (Expansin-A1 OS=Arabidopsis thaliana GN=EXPA1 PE=2 SV=1)

HSP 1 Score: 216.083 bits (549), Expect = 8.098e-56
Identity = 95/126 (75.40%), Postives = 110/126 (87.30%), Query Frame = 1
Query:  145 FAGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFELKCGGDPQWCNPGNPAILITATNFCPPNFAQPSDNGGWCNPPRPHFDLAMPMFLKLAQYRAGIVPV 522
            +AGG W +AHATFYGG DASGTMGGACGYGNLYSQGYG NTAALSTALFNNGLSCGACFE++C  D +WC PG  +I++TATNFCPPN A P++ GGWCNPP+ HFDL+ P+F ++AQYRAGIVPV
Sbjct:   22 YAGGGWVNAHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGACFEIRCQNDGKWCLPG--SIVVTATNFCPPNNALPNNAGGWCNPPQQHFDLSQPVFQRIAQYRAGIVPV 145          
BLAST of FC876226 vs. ExPASy Swiss-Prot
Match: EXP15_ARATH (Expansin-A15 OS=Arabidopsis thaliana GN=EXPA15 PE=2 SV=2)

HSP 1 Score: 215.312 bits (547), Expect = 1.381e-55
Identity = 100/142 (70.42%), Postives = 114/142 (80.28%), Query Frame = 1
Query:   97 VALSLFATANAKIPGVFAGGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFELKCGGDPQWCNPGNPAILITATNFCPPNFAQPSDNGGWCNPPRPHFDLAMPMFLKLAQYRAGIVPV 522
            +AL  FA     + G  AG  W +AHATFYGGSDASGTMGGACGYGNLYSQGYG NTAALSTALFNNGLSCGACFE+KC  D  WC PG  AI++TATNFCPPN A P++ GGWCNPP  HFDL+ P+F ++AQY+AG+VPV
Sbjct:   11 IALFCFAAMVCSVHGYDAG--WVNAHATFYGGSDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGACFEIKCQSDGAWCLPG--AIIVTATNFCPPNNALPNNAGGWCNPPLHHFDLSQPVFQRIAQYKAGVVPV 148          
BLAST of FC876226 vs. ExPASy Swiss-Prot
Match: EXPA2_ORYSJ (Expansin-A2 OS=Oryza sativa subsp. japonica GN=EXPA2 PE=2 SV=2)

HSP 1 Score: 209.92 bits (533), Expect = 5.803e-54
Identity = 90/123 (73.17%), Postives = 104/123 (84.55%), Query Frame = 1
Query:  154 GPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFELKCGGDPQWCNPGNPAILITATNFCPPNFAQPSDNGGWCNPPRPHFDLAMPMFLKLAQYRAGIVPV 522
            G WQSAHATFYGG DASGTMGGACGYGNLYS GYG NTAALST LFN+G +CG+C+EL+C  D QWC PG  ++ +TATN CPPN+A P+D+GGWCNPPRPHFD+A P FL++  YRAGIVPV
Sbjct:   27 GSWQSAHATFYGGGDASGTMGGACGYGNLYSTGYGTNTAALSTVLFNDGAACGSCYELRCDNDGQWCLPG--SVTVTATNLCPPNYALPNDDGGWCNPPRPHFDMAEPAFLQIGVYRAGIVPV 147          
BLAST of FC876226 vs. ExPASy Swiss-Prot
Match: EXP10_ARATH (Expansin-A10 OS=Arabidopsis thaliana GN=EXPA10 PE=2 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 5.803e-54
Identity = 93/124 (75.00%), Postives = 107/124 (86.29%), Query Frame = 1
Query:  151 GGPWQSAHATFYGGSDASGTMGGACGYGNLYSQGYGVNTAALSTALFNNGLSCGACFELKCGGDPQWCNPGNPAILITATNFCPPNFAQPSDNGGWCNPPRPHFDLAMPMFLKLAQYRAGIVPV 522
            GG W +AHATFYGG DASGTMGGACGYGNLYSQGYG +TAALSTALFNNGLSCG+CFE++C  D +WC PG  +I++TATNFCPPN A  ++NGGWCNPP  HFDLA P+F ++AQYRAGIVPV
Sbjct:   23 GGGWINAHATFYGGGDASGTMGGACGYGNLYSQGYGTSTAALSTALFNNGLSCGSCFEIRCENDGKWCLPG--SIVVTATNFCPPNNALANNNGGWCNPPLEHFDLAQPVFQRIAQYRAGIVPV 144          
The following BLAST results are available for this feature:
BLAST of FC876226 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 66
Match NameE-valueIdentityDescription
EXPA3_ARATH9.521e-7381.46Expansin-A3 OS=Arabidopsis thaliana GN=EXPA3 PE=2 ... [more]
EXPA6_ARATH1.053e-7182.52Expansin-A6 OS=Arabidopsis thaliana GN=EXPA6 PE=2 ... [more]
EXPA4_ARATH1.375e-7184.78Expansin-A4 OS=Arabidopsis thaliana GN=EXPA4 PE=1 ... [more]
EXPA9_ARATH7.544e-7079.19Expansin-A9 OS=Arabidopsis thaliana GN=EXPA9 PE=2 ... [more]
EXP16_ARATH4.577e-6775.68Expansin-A16 OS=Arabidopsis thaliana GN=EXPA16 PE=... [more]
EXPA7_ORYSJ3.875e-6679.17Expansin-A7 OS=Oryza sativa subsp. japonica GN=EXP... [more]
EXPA1_ARATH8.098e-5675.40Expansin-A1 OS=Arabidopsis thaliana GN=EXPA1 PE=2 ... [more]
EXP15_ARATH1.381e-5570.42Expansin-A15 OS=Arabidopsis thaliana GN=EXPA15 PE=... [more]
EXPA2_ORYSJ5.803e-5473.17Expansin-A2 OS=Oryza sativa subsp. japonica GN=EXP... [more]
EXP10_ARATH5.803e-5475.00Expansin-A10 OS=Arabidopsis thaliana GN=EXPA10 PE=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32002A07EF DevOvary1 Citrus clementina cDNA clone C32002A07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876226 ID=FC876226|Name=FC876226|organism=Citrus clementina|type=EST|length=522bp
ACCTCCTGCGCGCTCACTCACTCACTCACTCAACTCTCTGTCTCCCTCTC
TTCAACTCCAACAATGGCTCTTTTCAGAATGCTCTGCTTTTTCTCAGTGG
CACTCTCCTTATTTGCGACGGCCAACGCCAAGATTCCCGGTGTCTTCGCC
GGTGGCCCCTGGCAATCGGCCCACGCCACTTTTTACGGTGGCAGCGACGC
TTCCGGCACTATGGGTGGTGCTTGTGGGTACGGGAATCTGTACAGCCAGG
GCTATGGAGTGAACACGGCGGCTCTCAGTACGGCGCTGTTCAACAACGGC
TTGAGCTGCGGCGCGTGCTTCGAGTTAAAGTGCGGCGGCGACCCGCAATG
GTGTAACCCGGGTAACCCGGCCATTCTGATCACGGCGACCAACTTTTGCC
CCCCGAACTTCGCTCAGCCCTCCGATAATGGCGGGTGGTGCAACCCTCCT
CGCCCTCATTTCGATCTGGCCATGCCTATGTTCCTCAAGCTCGCCCAGTA
CCGCGCTGGTATCGTCCCCGTT
back to top