FC876228

Overview
NameFC876228
Unique NameFC876228
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length459
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC876228 vs. ExPASy Swiss-Prot
Match: PUB8_ARATH (U-box domain-containing protein 8 OS=Arabidopsis thaliana GN=PUB8 PE=2 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 1.600e-34
Identity = 74/113 (65.49%), Postives = 83/113 (73.45%), Query Frame = 3
Query:  135 MATQFPDDFNCPISLEIMSDPVILSSGHTFDRASIQRWLDSGHRTCPITKLPLPDQPSLIPNHALRSLISNFTRTPL-----PKPQLEHANPNPQTLISVLTSKSSPLESKLE 458
            MA   P+DF CPISLEIMSDPVIL SGHTFDR SIQ+W+DSG+RTCPITKLPL + P LIPNHALRSLI NF    L     P+ Q EH++   Q LIS L S+SS   SKLE
Sbjct:    1 MAFDLPNDFRCPISLEIMSDPVILQSGHTFDRVSIQQWIDSGNRTCPITKLPLSETPYLIPNHALRSLILNFAHVSLKESSRPRTQQEHSHSQSQALISTLVSQSSSNASKLE 113          
BLAST of FC876228 vs. ExPASy Swiss-Prot
Match: SL11_ORYSJ (Protein spotted leaf 11 OS=Oryza sativa subsp. japonica GN=SPL11 PE=1 SV=2)

HSP 1 Score: 90.5077 bits (223), Expect = 3.582e-18
Identity = 46/107 (42.99%), Postives = 62/107 (57.94%), Query Frame = 3
Query:   87 INPSRVSCVRDRVKVDMATQFPDDFNCPISLEIMSDPVILSSGHTFDRASIQRWLDSGHRTCPITKLPLPDQPSLIPNHALRSLISNFTRTPLPKPQLEHANPNPQT 407
            + P   S V D          PD+F CPISLE+M DPVI+S+G T++RA I++W+ SGH TCP T+  +    +L PN+ LRSLIS +  T   +P      PN  T
Sbjct:  253 MGPPMASRVLDSNGDSRPITIPDEFRCPISLELMKDPVIVSTGQTYERACIEKWIASGHHTCPTTQQKM-STSALTPNYVLRSLISQWCETNGMEPPKRSTQPNKPT 358          
BLAST of FC876228 vs. ExPASy Swiss-Prot
Match: SL11_ORYSI (Protein spotted leaf 11 OS=Oryza sativa subsp. indica GN=SPL11 PE=1 SV=2)

HSP 1 Score: 90.5077 bits (223), Expect = 3.582e-18
Identity = 46/107 (42.99%), Postives = 62/107 (57.94%), Query Frame = 3
Query:   87 INPSRVSCVRDRVKVDMATQFPDDFNCPISLEIMSDPVILSSGHTFDRASIQRWLDSGHRTCPITKLPLPDQPSLIPNHALRSLISNFTRTPLPKPQLEHANPNPQT 407
            + P   S V D          PD+F CPISLE+M DPVI+S+G T++RA I++W+ SGH TCP T+  +    +L PN+ LRSLIS +  T   +P      PN  T
Sbjct:  253 MGPPMASRVLDSNGDSRPITIPDEFRCPISLELMKDPVIVSTGQTYERACIEKWIASGHHTCPTTQQKM-STSALTPNYVLRSLISQWCETNGMEPPKRSTQPNKPT 358          
BLAST of FC876228 vs. ExPASy Swiss-Prot
Match: PUB13_ARATH (U-box domain-containing protein 13 OS=Arabidopsis thaliana GN=PUB13 PE=2 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 1.965e-16
Identity = 44/100 (44.00%), Postives = 64/100 (64.00%), Query Frame = 3
Query:  150 PDDFNCPISLEIMSDPVILSSGHTFDRASIQRWLDSGHRTCPITKLPLPDQPSLIPNHALRSLISNFTRTPLPKPQLEHANPNPQTLISVLTSKSSPLES 449
            PDDF CPISLE+M DPVI+SSG T++R  I++W++ GH TCP T+  L    +L PN+ LRSLI+ +      +P    ++  P+     ++S SSP E+
Sbjct:  257 PDDFRCPISLEMMRDPVIVSSGQTYERTCIEKWIEGGHSTCPKTQQAL-TSTTLTPNYVLRSLIAQWCEANDIEPPKPPSSLRPRK----VSSFSSPAEA 351          
BLAST of FC876228 vs. ExPASy Swiss-Prot
Match: PUB26_ARATH (U-box domain-containing protein 26 OS=Arabidopsis thaliana GN=PUB26 PE=2 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 2.567e-16
Identity = 42/90 (46.67%), Postives = 56/90 (62.22%), Query Frame = 3
Query:  129 VDMATQFPDDFNCPISLEIMSDPVILSSGHTFDRASIQRWLDSGHRTCPITKLPLPDQPSLIPNHALRSLISNF---------TRTPLPK 371
            +D+  Q P  F CPISL++MSDPV +S+G T+DR SI  W+  G+ TCP+T++ L D  +LIPNH LR LI  +          R P PK
Sbjct:    8 LDLGIQIPYHFRCPISLDLMSDPVTISTGQTYDRTSIDSWIAMGNTTCPVTRVALSDF-TLIPNHTLRRLIQEWCVANRSNGVERIPTPK 96          
BLAST of FC876228 vs. ExPASy Swiss-Prot
Match: PUB25_ARATH (U-box domain-containing protein 25 OS=Arabidopsis thaliana GN=PUB25 PE=2 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 3.352e-16
Identity = 48/115 (41.74%), Postives = 65/115 (56.52%), Query Frame = 3
Query:  129 VDMATQFPDDFNCPISLEIMSDPVILSSGHTFDRASIQRWLDSGHR-TCPITKLPLPDQPSLIPNHALRSLISNF---------TRTPLPKPQLEHANPNPQTLISVLTSKSSPL 443
            +D+  Q P  F CPISLE+M DPV + +G T+DRASI+ W+  G+  TCP+T+ PL D  +LIPNH LR LI  +          R P PK       P   T +  L S++S +
Sbjct:    8 LDLGIQIPYHFRCPISLELMQDPVTVCTGQTYDRASIESWVSIGNNTTCPVTRAPLSDF-TLIPNHTLRRLIQEWCVANRSNGVERIPTPK------QPADPTSVRALLSQASAI 115          
BLAST of FC876228 vs. ExPASy Swiss-Prot
Match: PUB12_ARATH (U-box domain-containing protein 12 OS=Arabidopsis thaliana GN=PUB12 PE=2 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 4.841e-15
Identity = 41/103 (39.81%), Postives = 62/103 (60.19%), Query Frame = 3
Query:  150 PDDFNCPISLEIMSDPVILSSGHTFDRASIQRWLDSGHRTCPITKLPLPDQPSLIPNHALRSLISNFTRTPLPKPQLEHANPNPQTLISVLTSKSSPLESKLE 458
            P++F CPISLE+M+DPVI+SSG T++R  I++WL+ GH TCP T+  L     + PN+ LRSLI+ +  +   +P        P +  S  +S      +K+E
Sbjct:  257 PEEFRCPISLELMTDPVIVSSGQTYERECIKKWLEGGHLTCPKTQETLTSD-IMTPNYVLRSLIAQWCESNGIEPPKRPNISQPSSKASSSSSAPDDEHNKIE 358          
BLAST of FC876228 vs. ExPASy Swiss-Prot
Match: PUB15_ARATH (U-box domain-containing protein 15 OS=Arabidopsis thaliana GN=PUB15 PE=2 SV=2)

HSP 1 Score: 79.7221 bits (195), Expect = 6.322e-15
Identity = 39/85 (45.88%), Postives = 57/85 (67.06%), Query Frame = 3
Query:  150 PDDFNCPISLEIMSDPVILSSGHTFDRASIQRWLDSGHRTCPITKLPLPDQPSLIPNHALRSLISNFTRTPLPKPQLEHANPNPQ 404
            P +F CPI+LEIM DPVI+++G T+++ SIQ+W D+GH+TCP T+  L D  SL PN AL++LI  +      K   +  +P+ Q
Sbjct:  291 PHEFLCPITLEIMLDPVIIATGQTYEKESIQKWFDAGHKTCPKTRQEL-DHLSLAPNFALKNLIMQWCEKNNFKIPEKEVSPDSQ 374          
BLAST of FC876228 vs. ExPASy Swiss-Prot
Match: PUB14_ARATH (U-box domain-containing protein 14 OS=Arabidopsis thaliana GN=PUB14 PE=1 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 6.322e-15
Identity = 36/65 (55.38%), Postives = 51/65 (78.46%), Query Frame = 3
Query:  150 PDDFNCPISLEIMSDPVILSSGHTFDRASIQRWLDSGHRTCPITKLPLPDQPSLIPNHALRSLIS 344
            P+ F CPISLE+M DPVI+S+G T++R+SIQ+WLD+GH+TCP ++  L     L PN+ L+SLI+
Sbjct:  249 PEYFRCPISLELMKDPVIVSTGQTYERSSIQKWLDAGHKTCPKSQETLL-HAGLTPNYVLKSLIA 312          
BLAST of FC876228 vs. ExPASy Swiss-Prot
Match: PUB17_ARATH (U-box domain-containing protein 17 OS=Arabidopsis thaliana GN=PUB17 PE=1 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 8.257e-15
Identity = 40/96 (41.67%), Postives = 60/96 (62.50%), Query Frame = 3
Query:  150 PDDFNCPISLEIMSDPVILSSGHTFDRASIQRWLDSGHRTCPITKLPLPDQPSLIPNHALRSLISNFTRTPLPKPQLEHANPNPQTLISVLTSKSS 437
            P DF CPISL++M+DPVI+S+G T+DR SI RW++ GH TCP T   L D   ++PN AL++LI  +        + E  +   ++  S L +K++
Sbjct:  306 PKDFVCPISLDLMTDPVIISTGQTYDRNSIARWIEEGHCTCPKTGQMLMDS-RIVPNRALKNLIVQWCTASGISYESEFTDSPNESFASALPTKAA 400          
The following BLAST results are available for this feature:
BLAST of FC876228 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 36
Match NameE-valueIdentityDescription
PUB8_ARATH1.600e-3465.49U-box domain-containing protein 8 OS=Arabidopsis t... [more]
SL11_ORYSJ3.582e-1842.99Protein spotted leaf 11 OS=Oryza sativa subsp. jap... [more]
SL11_ORYSI3.582e-1842.99Protein spotted leaf 11 OS=Oryza sativa subsp. ind... [more]
PUB13_ARATH1.965e-1644.00U-box domain-containing protein 13 OS=Arabidopsis ... [more]
PUB26_ARATH2.567e-1646.67U-box domain-containing protein 26 OS=Arabidopsis ... [more]
PUB25_ARATH3.352e-1641.74U-box domain-containing protein 25 OS=Arabidopsis ... [more]
PUB12_ARATH4.841e-1539.81U-box domain-containing protein 12 OS=Arabidopsis ... [more]
PUB15_ARATH6.322e-1545.88U-box domain-containing protein 15 OS=Arabidopsis ... [more]
PUB14_ARATH6.322e-1555.38U-box domain-containing protein 14 OS=Arabidopsis ... [more]
PUB17_ARATH8.257e-1541.67U-box domain-containing protein 17 OS=Arabidopsis ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32002A09EF DevOvary1 Citrus clementina cDNA clone C32002A09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876228 ID=FC876228|Name=FC876228|organism=Citrus clementina|type=EST|length=459bp
AGATAGGGGTCCTGCATTTGCTGGACAGATAGATGAAACTGAAAATCTCA
TAGGCAGCAGCAGCGGCAGCAGTTTCCAAAAACCTCATAAACCCCTCTCG
AGTTAGCTGTGTTCGAGACCGAGTCAAAGTAGATATGGCGACTCAGTTCC
CGGACGATTTCAATTGTCCGATTTCTCTAGAAATAATGTCCGACCCGGTC
ATACTCTCCTCTGGCCACACCTTTGACCGAGCGTCAATCCAACGGTGGCT
GGACTCCGGTCACCGTACTTGTCCAATTACTAAACTACCCCTCCCTGACC
AACCCTCTCTTATCCCCAACCACGCTCTGAGATCTTTAATTTCCAATTTT
ACCCGCACCCCATTACCGAAACCACAGCTCGAACACGCAAACCCGAACCC
ACAAACCCTAATCTCCGTGCTCACATCAAAATCTTCCCCTCTCGAGTCCA
AACTCGAGT
back to top