FC876232

Overview
NameFC876232
Unique NameFC876232
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length667
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig6685 contig Ccv1_Contig6685:11..677. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876232 vs. ExPASy Swiss-Prot
Match: RNPS1_DANRE (RNA-binding protein with serine-rich domain 1 OS=Danio rerio GN=rnps1 PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 7.602e-11
Identity = 33/87 (37.93%), Postives = 57/87 (65.52%), Query Frame = 3
Query:  408 LYIDSLSRNVNEGHLREIFSNFGEVVDVELVMDRA-VNLPRGSGYVRFKTRADAEKAQLYMDGAQIDGNVVHATFTLSLLKKVSPPP 665
            LY+  L+RNV + H++EIF+ +G++  +++  DR   N+ +G  YV +++  DA+KA  +MDG QIDG  + AT  L+  +++ P P
Sbjct:  139 LYLGRLTRNVTKDHIQEIFATYGKIKMIDMPSDRLHPNVSKGYAYVEYESPEDAQKALKHMDGGQIDGQEITATAILA--QRIRPAP 223          
The following BLAST results are available for this feature:
BLAST of FC876232 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
RNPS1_DANRE7.602e-1137.93RNA-binding protein with serine-rich domain 1 OS=D... [more]
back to top
Properties
Property NameValue
Genbank descriptionC32002B02EF DevOvary1 Citrus clementina cDNA clone C32002B02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876232 ID=FC876232|Name=FC876232|organism=Citrus clementina|type=EST|length=667bp
CTTTTAATCCACTCAATTGAAATTGAGGGGGTTTATCTAGGGTTCCATCT
CTGCACTCGTTACTCACTCCAGTGTCAATGGCGAATCCACCGCGGGGCCG
CCGCTCGCCCCCGTCGAGGTCCGCTTCCGGCTCATCATCCCGGTCCCGTT
CACGCTCCTACTCCGGTTCAGACTCCCGGTCCAGCTCCCGTTCTCTCTCC
TCCCGCTCTAGATCCCTTTCTCGCTCGCGCTCTTTATCTTCCTCTTCTTC
TCCTTCTCGTAGCACCAACTCTCGGAGCCGCAGCCCCCCGCCTCAACGCA
ATAAGAGTCCTGCTGTGGCAGCCAGGCGAGGTCGCTCCCCAGCTCCTCCA
TCTAAAAGAGCTTCTTCACCCCCAAGGAAAGCTTCCACAGAAAATGATTC
TCTTGTTCTCTACATTGACTCACTCAGCAGGAATGTGAATGAAGGCCATT
TGAGAGAAATATTCAGTAACTTTGGTGAAGTTGTGGATGTCGAGTTGGTT
ATGGACCGCGCTGTTAATCTTCCAAGAGGAAGTGGATATGTTCGTTTCAA
GACAAGGGCAGATGCTGAAAAGGCACAATTATACATGGATGGTGCCCAAA
TTGATGGGAATGTTGTTCATGCAACATTCACATTGTCTTTGCTGAAAAAA
GTTTCACCGCCTCCAAA
back to top