FC876309

Overview
NameFC876309
Unique NameFC876309
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length581
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10210 contig Ccv1_Contig10210:1..581. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876309 vs. ExPASy Swiss-Prot
Match: PIP25_ARATH (Probable aquaporin PIP2-5 OS=Arabidopsis thaliana GN=PIP2-5 PE=1 SV=1)

HSP 1 Score: 218.779 bits (556), Expect = 1.563e-56
Identity = 108/142 (76.06%), Postives = 114/142 (80.28%), Query Frame = 2
Query:  152 VAEHGSYSAKDYTDPPPEPLFDAVELTKWSFYRALIAEFIAXXXXXXXXXXXXIGYKSQTDPAKNVDGCAGVGILGIAWAFGGMIFVLVYCTASISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAISGVGLVKVFQN 577
            V +  S+S KDY DPPPEPLFDA EL KWSFYRALIAEFIA            IGYKSQTDPA N D C GVG+LGIAWAFGGMIF+LVYCTA ISGGHINPAVTFGL LARKV+LVRAVMYMVAQCLGAI GV LVK FQ+
Sbjct:    6 VGDKRSFSGKDYQDPPPEPLFDATELGKWSFYRALIAEFIATLLFLYVTIMTVIGYKSQTDPALNPDQCTGVGVLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLARKVTLVRAVMYMVAQCLGAICGVALVKAFQS 147          
BLAST of FC876309 vs. ExPASy Swiss-Prot
Match: PIP23_ORYSJ (Probable aquaporin PIP2-3 OS=Oryza sativa subsp. japonica GN=PIP2-3 PE=2 SV=1)

HSP 1 Score: 206.068 bits (523), Expect = 1.048e-52
Identity = 106/153 (69.28%), Postives = 116/153 (75.82%), Query Frame = 2
Query:  134 MAKD---TGVAEHGSYSAKDYTDPPPEPLFDAVELTKWSFYRALIAEFIAXXXXXXXXXXXXIGYKSQTDPAKNVD--GCAGVGILGIAWAFGGMIFVLVYCTASISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAISGVGLVKVFQN 577
            MAKD      AE G Y AKDY+DPPP PL DA ELTKWS YRA+IAEF+A            IGYK Q+DP  N     C+GVGILGIAWAFGGMIF+LVYCTA +SGGHINPAVTFGLFLARKVSLVRAV+Y+VAQ LGAI GVGLVK FQ+
Sbjct:    1 MAKDIEAAAAAEGGEYMAKDYSDPPPAPLIDAEELTKWSLYRAVIAEFVATLLFLYITVATVIGYKHQSDPGANAADAACSGVGILGIAWAFGGMIFILVYCTAGVSGGHINPAVTFGLFLARKVSLVRAVLYIVAQSLGAICGVGLVKGFQS 153          
BLAST of FC876309 vs. ExPASy Swiss-Prot
Match: PIP22_ORYSJ (Probable aquaporin PIP2-2 OS=Oryza sativa subsp. japonica GN=PIP2-2 PE=2 SV=1)

HSP 1 Score: 205.682 bits (522), Expect = 1.369e-52
Identity = 105/152 (69.08%), Postives = 115/152 (75.66%), Query Frame = 2
Query:  134 MAKD--TGVAEHGSYSAKDYTDPPPEPLFDAVELTKWSFYRALIAEFIAXXXXXXXXXXXXIGYKSQTDPAKNVD--GCAGVGILGIAWAFGGMIFVLVYCTASISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAISGVGLVKVFQN 577
            MAKD      E G +SAKDYTDPPP PL D  ELTKWS YRA+IAEFIA            IGYK Q+D   N     C+GVGILGIAWAFGGMIF+LVYCTA ISGGHINPAVTFGLFLARKVSL+RAV+Y++AQCLGAI GVGLVK FQ+
Sbjct:    1 MAKDIEASAPEGGEFSAKDYTDPPPAPLIDVEELTKWSLYRAVIAEFIATLLFLYITVATVIGYKHQSDATVNTTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYIIAQCLGAICGVGLVKGFQS 152          
BLAST of FC876309 vs. ExPASy Swiss-Prot
Match: PIP23_MAIZE (Aquaporin PIP2-3 OS=Zea mays GN=PIP2-3 PE=2 SV=1)

HSP 1 Score: 203.756 bits (517), Expect = 5.203e-52
Identity = 103/142 (72.54%), Postives = 112/142 (78.87%), Query Frame = 2
Query:  158 EHGSYSAKDYTDPPPEPLFDAVELTKWSFYRALIAEFIAXXXXXXXXXXXXIGYKSQTDPAKNVD--GCAGVGILGIAWAFGGMIFVLVYCTASISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAISGVGLVKVFQN 577
            E G +SAKDYTDPPP PL DA ELTKWS YRA+IAEFIA            IGYK QTD A +     C GVGILGIAWAFGGMIF+LVYCTA ISGGHINPAVTFGLFLARKVSLVRA++Y++AQCLGAI GVGLVK FQ+
Sbjct:   12 EAGEFSAKDYTDPPPAPLIDADELTKWSLYRAVIAEFIATLLFLYITVATVIGYKHQTDAAASGPDAACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRALLYIIAQCLGAICGVGLVKGFQS 153          
BLAST of FC876309 vs. ExPASy Swiss-Prot
Match: PIP24_MAIZE (Aquaporin PIP2-4 OS=Zea mays GN=PIP2-4 PE=1 SV=1)

HSP 1 Score: 203.371 bits (516), Expect = 6.796e-52
Identity = 105/152 (69.08%), Postives = 117/152 (76.97%), Query Frame = 2
Query:  134 MAKDTGVA--EHGSYSAKDYTDPPPEPLFDAVELTKWSFYRALIAEFIAXXXXXXXXXXXXIGYKSQTDPAKNVD--GCAGVGILGIAWAFGGMIFVLVYCTASISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAISGVGLVKVFQN 577
            MAKD   +  E G +SAKDYTDPPP PL DA ELT+WS YRA+IAEFIA            IGYK QTD + +     C GVGILGIAWAFGGMIF+LVYCTA ISGGHINPAVTFGLFLARKVSLVRA++Y++AQCLGAI GVGLVK FQ+
Sbjct:    1 MAKDIEASGPEAGEFSAKDYTDPPPAPLIDAEELTQWSLYRAVIAEFIATLLFLYITVATVIGYKHQTDASASGPDAACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRALLYIIAQCLGAICGVGLVKGFQS 152          
BLAST of FC876309 vs. ExPASy Swiss-Prot
Match: PIP22_MAIZE (Aquaporin PIP2-2 OS=Zea mays GN=PIP2-2 PE=2 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 3.373e-51
Identity = 105/155 (67.74%), Postives = 115/155 (74.19%), Query Frame = 2
Query:  134 MAKDTGV---AEHGSYSAKDYTDPPPEPLFDAVELTKWSFYRALIAEFIAXXXXXXXXXXXXIGYKSQTDPAKNVDG----CAGVGILGIAWAFGGMIFVLVYCTASISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAISGVGLVKVFQN 577
            M KD  V   A  G ++AKDYTDPPP PL DA EL  WS YRA+IAEFIA            IGYK QTD + +  G    C GVG+LGIAWAFGGMIFVLVYCTA ISGGHINPAVTFGLFLARKVSLVRA++YMVAQCLGA+ GVGLVK FQ+
Sbjct:    1 MGKDDVVQSGAGGGEFAAKDYTDPPPAPLVDAAELGSWSLYRAVIAEFIATLLFLYVTVATVIGYKHQTDASASGAGADAACGGVGVLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRALLYMVAQCLGAVCGVGLVKAFQS 155          
BLAST of FC876309 vs. ExPASy Swiss-Prot
Match: PIP21_ORYSJ (Probable aquaporin PIP2-1 OS=Oryza sativa subsp. japonica GN=PIP2-1 PE=2 SV=1)

HSP 1 Score: 199.519 bits (506), Expect = 9.813e-51
Identity = 100/140 (71.43%), Postives = 109/140 (77.86%), Query Frame = 2
Query:  164 GSYSAKDYTDPPPEPLFDAVELTKWSFYRALIAEFIAXXXXXXXXXXXXIGYKSQTDP-AKNVDG-CAGVGILGIAWAFGGMIFVLVYCTASISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAISGVGLVKVFQN 577
            G ++AKDYTDPPP PL DA EL  WS YRA+IAEFIA            IGYK QTD  A   D  C GVG+LGIAWAFGGMIF+LVYCTA ISGGHINPAVTFGLFLARKVSLVRA++Y+VAQCLGAI GVGLVK FQ+
Sbjct:   14 GEFAAKDYTDPPPAPLIDAAELGSWSLYRAVIAEFIATLLFLYITVATVIGYKHQTDASASGADAACGGVGVLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAILYIVAQCLGAICGVGLVKAFQS 153          
BLAST of FC876309 vs. ExPASy Swiss-Prot
Match: PIP21_MAIZE (Aquaporin PIP2-1 OS=Zea mays GN=PIP2-1 PE=1 SV=2)

HSP 1 Score: 199.519 bits (506), Expect = 9.813e-51
Identity = 105/153 (68.63%), Postives = 114/153 (74.51%), Query Frame = 2
Query:  134 MAKDTGV---AEHGSYSAKDYTDPPPEPLFDAVELTKWSFYRALIAEFIAXXXXXXXXXXXXIGYKSQTDP-AKNVDG-CAGVGILGIAWAFGGMIFVLVYCTASISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAISGVGLVKVFQN 577
            M KD  +   A  G ++AKDYTDPPP PL DA EL  WS YRA+IAEFIA            IGYK QTD  A   D  C GVG+LGIAWAFGGMIFVLVYCTA ISGGHINPAVTFGLFLARKVSLVRA++Y+VAQCLGAI GVGLVK FQ+
Sbjct:    1 MGKDDVIESGAGGGEFAAKDYTDPPPAPLIDAAELGSWSLYRAVIAEFIATLLFLYITVATVIGYKHQTDASASGADAACGGVGVLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRALLYIVAQCLGAICGVGLVKAFQS 153          
BLAST of FC876309 vs. ExPASy Swiss-Prot
Match: PIP23_ARATH (Aquaporin PIP2-3 OS=Arabidopsis thaliana GN=PIP2-3 PE=1 SV=1)

HSP 1 Score: 198.364 bits (503), Expect = 2.186e-50
Identity = 100/148 (67.57%), Postives = 109/148 (73.65%), Query Frame = 2
Query:  134 MAKDTGVAEHGSYSAKDYTDPPPEPLFDAVELTKWSFYRALIAEFIAXXXXXXXXXXXXIGYKSQTDPAKNVDGCAGVGILGIAWAFGGMIFVLVYCTASISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAISGVGLVKVFQN 577
            MAKD  V     +  +DY DPPP P FDA ELTKWS YRA+IAEF+A            IGYK Q+D       C GVGILGIAWAFGGMIF+LVYCTA ISGGHINPAVTFGLFLARKVSL+RAV+YMVAQCLGAI GVG VK FQ+
Sbjct:    1 MAKD--VEGPDGFQTRDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLTVIGYKIQSDTKAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGFVKAFQS 146          
BLAST of FC876309 vs. ExPASy Swiss-Prot
Match: PIP22_ARATH (Aquaporin PIP2-2 OS=Arabidopsis thaliana GN=PIP2-2 PE=1 SV=2)

HSP 1 Score: 198.364 bits (503), Expect = 2.186e-50
Identity = 100/148 (67.57%), Postives = 109/148 (73.65%), Query Frame = 2
Query:  134 MAKDTGVAEHGSYSAKDYTDPPPEPLFDAVELTKWSFYRALIAEFIAXXXXXXXXXXXXIGYKSQTDPAKNVDGCAGVGILGIAWAFGGMIFVLVYCTASISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAISGVGLVKVFQN 577
            MAKD    E   +  +DY DPPP P FDA ELTKWS YRA+IAEF+A            IGYK Q+D       C GVGILGIAWAFGGMIF+LVYCTA ISGGHINPAVTFGLFLARKVSL+RAV+YMVAQCLGAI GVG VK FQ+
Sbjct:    1 MAKDVEGPE--GFQTRDYEDPPPTPFFDADELTKWSLYRAVIAEFVATLLFLYITVLTVIGYKIQSDTKAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGFVKAFQS 146          
The following BLAST results are available for this feature:
BLAST of FC876309 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 70
Match NameE-valueIdentityDescription
PIP25_ARATH1.563e-5676.06Probable aquaporin PIP2-5 OS=Arabidopsis thaliana ... [more]
PIP23_ORYSJ1.048e-5269.28Probable aquaporin PIP2-3 OS=Oryza sativa subsp. j... [more]
PIP22_ORYSJ1.369e-5269.08Probable aquaporin PIP2-2 OS=Oryza sativa subsp. j... [more]
PIP23_MAIZE5.203e-5272.54Aquaporin PIP2-3 OS=Zea mays GN=PIP2-3 PE=2 SV=1[more]
PIP24_MAIZE6.796e-5269.08Aquaporin PIP2-4 OS=Zea mays GN=PIP2-4 PE=1 SV=1[more]
PIP22_MAIZE3.373e-5167.74Aquaporin PIP2-2 OS=Zea mays GN=PIP2-2 PE=2 SV=1[more]
PIP21_ORYSJ9.813e-5171.43Probable aquaporin PIP2-1 OS=Oryza sativa subsp. j... [more]
PIP21_MAIZE9.813e-5168.63Aquaporin PIP2-1 OS=Zea mays GN=PIP2-1 PE=1 SV=2[more]
PIP23_ARATH2.186e-5067.57Aquaporin PIP2-3 OS=Arabidopsis thaliana GN=PIP2-3... [more]
PIP22_ARATH2.186e-5067.57Aquaporin PIP2-2 OS=Arabidopsis thaliana GN=PIP2-2... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32003B12EF DevOvary1 Citrus clementina cDNA clone C32003B12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876309 ID=FC876309|Name=FC876309|organism=Citrus clementina|type=EST|length=581bp
GNGATCCAAAAACAAGCAAAAAAAAAGAAAAAGAAAAAGAAAAAGGAAAA
GGCTTCTCTCTCGTTGTGCTTGTGGCTTTGCAGTGCTCTCAGTTTTCTCT
GTTTCTCTCCAAATCATTGTTACTGGTTTTCCAATGGCGAAGGACACTGG
GGTGGCAGAGCACGGCTCATATTCAGCCAAGGACTACACGGACCCACCGC
CGGAGCCGCTATTCGACGCCGTGGAGCTGACCAAATGGTCATTCTACAGA
GCCTTGATAGCTGAGTTCATAGCAACCCTGCTCTTTCTTTACGTCACTGT
CTTGACTGTCATTGGCTACAAAAGCCAGACCGATCCCGCCAAGAACGTCG
ACGGCTGTGCCGGCGTCGGCATCCTCGGCATCGCCTGGGCCTTCGGTGGC
ATGATCTTTGTCCTCGTTTACTGCACCGCCAGTATCTCAGGTGGTCACAT
TAACCCGGCAGTGACGTTCGGACTATTCTTGGCCCGCAAGGTGTCGTTGG
TCCGTGCTGTGATGTACATGGTGGCGCAGTGCCTTGGTGCTATCTCCGGT
GTTGGGTTGGTCAAGGTTTTCCAAAATCTTA
back to top