FC876313

Overview
NameFC876313
Unique NameFC876313
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length714
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10228 contig Ccv1_Contig10228:4..717. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876313 vs. ExPASy Swiss-Prot
Match: PSBO_SOLTU (Oxygen-evolving enhancer protein 1, chloroplastic OS=Solanum tuberosum GN=PSBO PE=2 SV=1)

HSP 1 Score: 328.176 bits (840), Expect = 2.710e-89
Identity = 168/204 (82.35%), Postives = 178/204 (87.25%), Query Frame = 3
Query:  102 MAASLQAAATLMQPTKVGVVPAXXXXXXXXXXXXVSKAFGVDSAGARISCSLNNDLKDLAQKCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKYQAKKFCLEPTSFTVKAEGVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAAVTXQL 713
            MAASLQAAATLMQPTKVG V A            VSKAFG++ + +R+SCSL  DLKD AQKC DA KIAGFALATSALVVSGA+AEGVPKRLT+DEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKY AKKFCLEPTSFTVKAEGV+KN+ PDFQ TKLMTRLTYTLDEIEGPFEVSPDGT+KF EKDGIDYAAVT QL
Sbjct:    1 MAASLQAAATLMQPTKVGGVSARNNLQLRSSQS-VSKAFGLEPSASRLSCSLQTDLKDFAQKCTDAAKIAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKYNAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLDEIEGPFEVSPDGTVKFEEKDGIDYAAVTVQL 203          
BLAST of FC876313 vs. ExPASy Swiss-Prot
Match: PSBO_TOBAC (Oxygen-evolving enhancer protein 1, chloroplastic OS=Nicotiana tabacum GN=PSBO PE=2 SV=1)

HSP 1 Score: 327.791 bits (839), Expect = 3.539e-89
Identity = 169/204 (82.84%), Postives = 177/204 (86.76%), Query Frame = 3
Query:  102 MAASLQAAATLMQPTKVGVVPAXXXXXXXXXXXXVSKAFGVDSAGARISCSLNNDLKDLAQKCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKYQAKKFCLEPTSFTVKAEGVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAAVTXQL 713
            MAASLQAAATLMQPTKVGV PA            VSKAFGV+ A AR++CSL  +LKDLAQK  DA K+AGFALATSALVVSGA+AEGVPKRLT+DEIQSKTYMEVKGTGTANQCPTIDGGV SFAFKPGKY AKKFCLEPTSFTVKAE VNKNAPPDFQ TKLMTRLTYTLDEIEGPFEVS DGT+KF EKDGIDYAAVT QL
Sbjct:    1 MAASLQAAATLMQPTKVGVAPARNNLQLRSAQS-VSKAFGVEPAAARLTCSLQTELKDLAQKFTDAAKVAGFALATSALVVSGANAEGVPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVASFAFKPGKYNAKKFCLEPTSFTVKAESVNKNAPPDFQKTKLMTRLTYTLDEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQL 203          
BLAST of FC876313 vs. ExPASy Swiss-Prot
Match: PSBO_SOLLC (Oxygen-evolving enhancer protein 1, chloroplastic OS=Solanum lycopersicum GN=PSBO PE=2 SV=2)

HSP 1 Score: 321.242 bits (822), Expect = 3.313e-87
Identity = 164/204 (80.39%), Postives = 175/204 (85.78%), Query Frame = 3
Query:  102 MAASLQAAATLMQPTKVGVVPAXXXXXXXXXXXXVSKAFGVDSAGARISCSLNNDLKDLAQKCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKYQAKKFCLEPTSFTVKAEGVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAAVTXQL 713
            MAASLQAAATLMQPTKVGV               VSKAFGV+    R++CSL  ++K+LAQKC DA KIAGFALATSALVVSGA+AEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTI+GGV SFAFKPGKY AKKFCLEPTSFTVKAEGV+KN+ PDFQ TKLMTRLTYTLDEIEGPFEVSPDGT+KF EKDGIDYAAVT QL
Sbjct:    1 MAASLQAAATLMQPTKVGV----RNNLQLRSAQSVSKAFGVEQGSGRLTCSLQTEIKELAQKCTDAAKIAGFALATSALVVSGANAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIEGGVGSFAFKPGKYTAKKFCLEPTSFTVKAEGVSKNSAPDFQKTKLMTRLTYTLDEIEGPFEVSPDGTVKFEEKDGIDYAAVTVQL 200          
BLAST of FC876313 vs. ExPASy Swiss-Prot
Match: PSBO_PEA (Oxygen-evolving enhancer protein 1, chloroplastic OS=Pisum sativum GN=PSBO PE=2 SV=1)

HSP 1 Score: 305.834 bits (782), Expect = 1.440e-82
Identity = 156/204 (76.47%), Postives = 172/204 (84.31%), Query Frame = 3
Query:  102 MAASLQAAATLMQPTKVGVVPAXXXXXXXXXXXXVSKAFGVDSAGARISCSLNNDLKDLAQKCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKYQAKKFCLEPTSFTVKAEGVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAAVTXQL 713
            MAASLQAAATLMQPTK+                 VSKAFG++  GA+++CSL +D K+LA KCV+A+KIAGFALATSALVVSGASAEG PKRLT+DEIQSKTY+EVKGTGTANQCPTIDGGVDSF+FKPGKY AKK CLEPTSFTVK+EGV KN P  FQNTKLMTRLTYTLDEIEGPFEVS DG++KF EKDGIDYAAVT QL
Sbjct:    1 MAASLQAAATLMQPTKL-----RSNTLQLKSNQSVSKAFGLEHYGAKVTCSLQSDFKELAHKCVEASKIAGFALATSALVVSGASAEGAPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGVDSFSFKPGKYNAKKLCLEPTSFTVKSEGVTKNTPLAFQNTKLMTRLTYTLDEIEGPFEVSADGSVKFEEKDGIDYAAVTVQL 199          
BLAST of FC876313 vs. ExPASy Swiss-Prot
Match: PSBO2_ARATH (Oxygen-evolving enhancer protein 1-2, chloroplastic OS=Arabidopsis thaliana GN=PSBO2 PE=1 SV=1)

HSP 1 Score: 299.671 bits (766), Expect = 1.032e-80
Identity = 150/204 (73.53%), Postives = 168/204 (82.35%), Query Frame = 3
Query:  102 MAASLQAAATLMQPTKVGVVPAXXXXXXXXXXXXVSKAFGVDSAGARISCSLNNDLKDLAQKCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKYQAKKFCLEPTSFTVKAEGVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAAVTXQL 713
            MA SLQAAAT +QP K+   P+            V K+FG+DS+ AR++CSL++DLKD A KC DA KIAGFALATSALVVSGA AEG PKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG ++F+FK GKY  KKFC EPTSFTVKA+ V+KNAPPDFQNTKLMTRLTYTLDEIEGPFEV  DG++KF E+DGIDYAAVT QL
Sbjct:    1 MATSLQAAATFLQPAKIAASPSRNVHLRSNQT--VGKSFGLDSSQARLTCSLHSDLKDFAGKCSDAAKIAGFALATSALVVSGAGAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGSETFSFKAGKYTGKKFCFEPTSFTVKADSVSKNAPPDFQNTKLMTRLTYTLDEIEGPFEVGSDGSVKFKEEDGIDYAAVTVQL 202          
BLAST of FC876313 vs. ExPASy Swiss-Prot
Match: PSBO_FRIAG (Oxygen-evolving enhancer protein 1, chloroplastic OS=Fritillaria agrestis GN=PSBO PE=2 SV=1)

HSP 1 Score: 298.13 bits (762), Expect = 3.003e-80
Identity = 153/205 (74.63%), Postives = 175/205 (85.37%), Query Frame = 3
Query:  102 MAASLQAAATLMQPTKVGVVPAXXXXXXXXXXXXVSKAFGVDSAGA-RISCSLNNDLKDLAQKCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKYQAKKFCLEPTSFTVKAEGVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAAVTXQL 713
            MA+SLQAAATL+ P KVG  PA            +SKAFG D++ A R++CS+N+DL+D+AQKC DA K+AGFALATSALV+SGASAEGVPKRLT+DEIQSKTYMEVKG+GTANQCPTI+GG +SF +K GKY  KK CLEPTSFTVKAEG+NKNAPP+FQ TKLMTRLTYTLDEIEGPFEV+PDGT+KF EKDGIDYAAVT QL
Sbjct:    1 MASSLQAAATLI-PAKVGA-PARTHLRSNSH---LSKAFGFDNSTAGRLTCSINSDLRDIAQKCTDAAKLAGFALATSALVISGASAEGVPKRLTFDEIQSKTYMEVKGSGTANQCPTIEGGTESFGYKTGKYTLKKLCLEPTSFTVKAEGINKNAPPEFQKTKLMTRLTYTLDEIEGPFEVAPDGTVKFEEKDGIDYAAVTVQL 200          
BLAST of FC876313 vs. ExPASy Swiss-Prot
Match: PSBO_SPIOL (Oxygen-evolving enhancer protein 1, chloroplastic OS=Spinacia oleracea GN=PSBO PE=1 SV=1)

HSP 1 Score: 294.664 bits (753), Expect = 3.320e-79
Identity = 154/206 (74.76%), Postives = 170/206 (82.52%), Query Frame = 3
Query:  102 MAASLQAAATLMQPTKVGVVPAXXXXXXXXXXXXVSKAFGVDSA--GARISCSLNNDLKDLAQKCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKYQAKKFCLEPTSFTVKAEGVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAAVTXQL 713
            MAASLQA+ T +QPTKV    A            V KAFGV+SA  G R+S SL +DLK+LA KCVDATK+AG ALATSAL+ SGA+AEG  KRLTYDEIQSKTY+EVKGTGTANQCPT++GGVDSFAFKPGKY AKKFCLEPT F VKAEG++KN+ PDFQNTKLMTRLTYTLDEIEGPFEVS DGT+KF EKDGIDYAAVT QL
Sbjct:    1 MAASLQASTTFLQPTKV----ASRNTLQLRSTQNVCKAFGVESASSGGRLSLSLQSDLKELANKCVDATKLAGLALATSALIASGANAEG-GKRLTYDEIQSKTYLEVKGTGTANQCPTVEGGVDSFAFKPGKYTAKKFCLEPTKFAVKAEGISKNSGPDFQNTKLMTRLTYTLDEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQL 201          
BLAST of FC876313 vs. ExPASy Swiss-Prot
Match: PSBO1_ARATH (Oxygen-evolving enhancer protein 1-1, chloroplastic OS=Arabidopsis thaliana GN=PSBO1 PE=1 SV=2)

HSP 1 Score: 290.812 bits (743), Expect = 4.794e-78
Identity = 143/204 (70.10%), Postives = 165/204 (80.88%), Query Frame = 3
Query:  102 MAASLQAAATLMQPTKVGVVPAXXXXXXXXXXXXVSKAFGVDSAGARISCSLNNDLKDLAQKCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKYQAKKFCLEPTSFTVKAEGVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAAVTXQL 713
            MAASLQ+ AT +Q  K+   P+            V K+FG++++ AR++CS  +D KD   KC DA KIAGFALATSALVVSGASAEG PKRLTYDEIQSKTYMEVKGTGTANQCPTIDGG ++F+FKPGKY  KKFC EPTSFTVKA+ V+KNAPP+FQNTKLMTRLTYTLDEIEGPFEV+ DG++ F E+DGIDYAAVT QL
Sbjct:    1 MAASLQSTATFLQSAKIATAPSRGSSHLRSTQA-VGKSFGLETSSARLTCSFQSDFKDFTGKCSDAVKIAGFALATSALVVSGASAEGAPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGSETFSFKPGKYAGKKFCFEPTSFTVKADSVSKNAPPEFQNTKLMTRLTYTLDEIEGPFEVASDGSVNFKEEDGIDYAAVTVQL 203          
BLAST of FC876313 vs. ExPASy Swiss-Prot
Match: PSBO_WHEAT (Oxygen-evolving enhancer protein 1, chloroplastic OS=Triticum aestivum GN=PSBO PE=2 SV=1)

HSP 1 Score: 283.878 bits (725), Expect = 5.861e-76
Identity = 148/204 (72.55%), Postives = 166/204 (81.37%), Query Frame = 3
Query:  102 MAASLQAAATLMQPTKVGVVPAXXXXXXXXXXXXVSKAFGVDSAGARISCSLNNDLKDLAQKCVDATKIAGFALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKYQAKKFCLEPTSFTVKAEGVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAAVTXQL 713
            MAASLQAAAT+M P K+G                V++AFGVD AGARI+CSL +D++++A KC DA K+AGFALATSAL+VSGA+AEG PKRLT+DEIQSKTYMEVKGTGTANQCPTIDGGVDSF FK GKY+ KKFCLEPTSFTVKAEG+ KN PP FQ TKLMTRLTYTLDE+EGP EV    T+KF EKDGIDYAAVT QL
Sbjct:    1 MAASLQAAATVM-PAKIG-----GRASSARPSSHVARAFGVD-AGARITCSLQSDIREVASKCADAAKMAGFALATSALLVSGATAEGAPKRLTFDEIQSKTYMEVKGTGTANQCPTIDGGVDSFPFKAGKYEMKKFCLEPTSFTVKAEGIQKNEPPRFQKTKLMTRLTYTLDEMEGPLEVRRRRTLKFEEKDGIDYAAVTVQL 197          
BLAST of FC876313 vs. ExPASy Swiss-Prot
Match: PSBO_VOLCA (Oxygen-evolving enhancer protein 1, chloroplastic OS=Volvox carteri GN=PSBO PE=2 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 3.367e-31
Identity = 68/134 (50.75%), Postives = 85/134 (63.43%), Query Frame = 3
Query:  315 FALATSALVVSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTID-GGVDSFAFKPGKYQAKKFCLEPTSFTVKAEGVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAAVTXQL 713
            F  A +A+V + A   G    LTYDE+Q  TY++VKGTG AN CP ++ G  D      G Y+ + FC+EPTSFTVK E V K    +F  TKLMTRLTYTLD + G  +V  DG+ +  E+DGIDYAA T QL
Sbjct:   32 FGQAAAAVVAASALVAGSANALTYDELQGLTYLQVKGTGIANTCPVLEKGSTDLSELSAGTYKLENFCIEPTSFTVKEESVFKGGETEFVKTKLMTRLTYTLDAMSGTLKVGSDGSAELKEEDGIDYAATTVQL 165          
The following BLAST results are available for this feature:
BLAST of FC876313 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 18
Match NameE-valueIdentityDescription
PSBO_SOLTU2.710e-8982.35Oxygen-evolving enhancer protein 1, chloroplastic ... [more]
PSBO_TOBAC3.539e-8982.84Oxygen-evolving enhancer protein 1, chloroplastic ... [more]
PSBO_SOLLC3.313e-8780.39Oxygen-evolving enhancer protein 1, chloroplastic ... [more]
PSBO_PEA1.440e-8276.47Oxygen-evolving enhancer protein 1, chloroplastic ... [more]
PSBO2_ARATH1.032e-8073.53Oxygen-evolving enhancer protein 1-2, chloroplasti... [more]
PSBO_FRIAG3.003e-8074.63Oxygen-evolving enhancer protein 1, chloroplastic ... [more]
PSBO_SPIOL3.320e-7974.76Oxygen-evolving enhancer protein 1, chloroplastic ... [more]
PSBO1_ARATH4.794e-7870.10Oxygen-evolving enhancer protein 1-1, chloroplasti... [more]
PSBO_WHEAT5.861e-7672.55Oxygen-evolving enhancer protein 1, chloroplastic ... [more]
PSBO_VOLCA3.367e-3150.75Oxygen-evolving enhancer protein 1, chloroplastic ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32003C05EF DevOvary1 Citrus clementina cDNA clone C32003C05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876313 ID=FC876313|Name=FC876313|organism=Citrus clementina|type=EST|length=714bp
GCCTCCACATACAAAACAAGTAATCCTCTGTAAAGAGTTTAGTTTGTTTC
TTAGAAGATAAAGGGATACTAGCAAGTAACCCACAAGTGGTAGGGAGCAA
GATGGCAGCCTCGTTACAAGCCGCAGCTACACTGATGCAACCCACCAAGG
TGGGTGTGGTACCCGCTCGCAGCAGCAGCCTGCAGCTGAGGTCTTCACAG
AGCGTTTCGAAGGCTTTTGGTGTCGACTCAGCTGGTGCTAGGATCTCTTG
CTCTTTGAATAATGACTTGAAGGATTTGGCTCAGAAATGTGTTGATGCTA
CCAAGATCGCTGGCTTTGCCCTCGCCACTTCTGCTCTCGTCGTTTCGGGA
GCAAGTGCTGAAGGTGTTCCAAAGAGGCTAACCTATGATGAAATCCAGAG
CAAGACATACATGGAAGTGAAGGGAACCGGAACTGCTAACCAGTGCCCAA
CCATTGATGGCGGAGTTGACTCTTTTGCCTTCAAACCTGGCAAATACCAG
GCTAAGAAGTTCTGCCTAGAACCAACTTCCTTCACTGTCAAGGCTGAGGG
TGTCAACAAGAATGCCCCACCAGATTTCCAGAACACCAAGCTCATGACCC
GCCTTACCTACACCCTTGACGAGATTGAGGGACCTTTTGAAGTGTCCCCC
GATGGCACCATTAAGTTTGTGGAGAAGGATGGAATTGACTATGCTGCTGT
GACAGNTCAGCTGG
back to top