FC876316

Overview
NameFC876316
Unique NameFC876316
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length298
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10260 contig Ccv1_Contig10260:13..310. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876316 vs. ExPASy Swiss-Prot
Match: CHS2_CITSI (Chalcone synthase 2 OS=Citrus sinensis GN=CHS2 PE=2 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 1.410e-41
Identity = 80/84 (95.24%), Postives = 83/84 (98.81%), Query Frame = 1
Query:   46 MATVQEIRNAQRADGPATVLAIGTATPAHSANQADYPDYYFRITKSEHMTELKEKFRRMCDKSMIKKRHMHLTEEILKENPNMC 297
            MATVQEIRNAQRADGPATVLAIGTATPAHS NQADYPDYYFRITKSEHMTELKEKF+RMCDKSMIKKR+M+LTEEILKENPNMC
Sbjct:    1 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMC 84          
BLAST of FC876316 vs. ExPASy Swiss-Prot
Match: CHS3_RUTGR (Chalcone synthase 3 OS=Ruta graveolens GN=CHS3 PE=2 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 2.751e-37
Identity = 72/82 (87.80%), Postives = 78/82 (95.12%), Query Frame = 1
Query:   52 TVQEIRNAQRADGPATVLAIGTATPAHSANQADYPDYYFRITKSEHMTELKEKFRRMCDKSMIKKRHMHLTEEILKENPNMC 297
            TV+EIR AQRADGPATVLAIGTATPA+   QADYPDYYFRITKSEHMT+LKEKF+RMCDKSMI+KR+MHLTEEILKENPNMC
Sbjct:    5 TVEEIRKAQRADGPATVLAIGTATPANYVTQADYPDYYFRITKSEHMTDLKEKFKRMCDKSMIRKRYMHLTEEILKENPNMC 86          
BLAST of FC876316 vs. ExPASy Swiss-Prot
Match: CHSY_DIAMO (Chalcone synthase OS=Dianthus monspessulanus GN=CHS PE=2 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 6.129e-37
Identity = 70/84 (83.33%), Postives = 80/84 (95.24%), Query Frame = 1
Query:   46 MATVQEIRNAQRADGPATVLAIGTATPAHSANQADYPDYYFRITKSEHMTELKEKFRRMCDKSMIKKRHMHLTEEILKENPNMC 297
            MA+++EIR AQRADGPAT+LAIGTATP ++  QADYPDYYFR+TKSEHMTELKEKFRRMCDKSMIKKR+M+LTEEILKENPN+C
Sbjct:    1 MASIEEIRQAQRADGPATILAIGTATPPNAIYQADYPDYYFRVTKSEHMTELKEKFRRMCDKSMIKKRYMYLTEEILKENPNLC 84          
BLAST of FC876316 vs. ExPASy Swiss-Prot
Match: CHSY_DIACA (Chalcone synthase OS=Dianthus caryophyllus GN=CHS PE=2 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 3.042e-36
Identity = 69/84 (82.14%), Postives = 79/84 (94.05%), Query Frame = 1
Query:   46 MATVQEIRNAQRADGPATVLAIGTATPAHSANQADYPDYYFRITKSEHMTELKEKFRRMCDKSMIKKRHMHLTEEILKENPNMC 297
            MA+++EIR A RADGPAT+LAIGTATP ++  QADYPDYYFR+TKSEHMTELKEKFRRMCDKSMIKKR+M+LTEEILKENPN+C
Sbjct:    1 MASIEEIRQAPRADGPATILAIGTATPPNAIYQADYPDYYFRVTKSEHMTELKEKFRRMCDKSMIKKRYMYLTEEILKENPNLC 84          
BLAST of FC876316 vs. ExPASy Swiss-Prot
Match: CHS2_RUTGR (Chalcone synthase 2 OS=Ruta graveolens GN=CHS2 PE=2 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 5.188e-36
Identity = 70/82 (85.37%), Postives = 77/82 (93.90%), Query Frame = 1
Query:   52 TVQEIRNAQRADGPATVLAIGTATPAHSANQADYPDYYFRITKSEHMTELKEKFRRMCDKSMIKKRHMHLTEEILKENPNMC 297
            TV+EIR AQRADGPA VLAIGTATPA+   QADYPDYYFRITKSEHMTELKEKF+RMCDKSMI+KR+M+LTE+ILKENPNMC
Sbjct:    5 TVEEIRKAQRADGPAAVLAIGTATPANYVTQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIRKRYMYLTEDILKENPNMC 86          
BLAST of FC876316 vs. ExPASy Swiss-Prot
Match: CHS1_RUTGR (Chalcone synthase 1 OS=Ruta graveolens GN=CHS1 PE=2 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 5.188e-36
Identity = 70/82 (85.37%), Postives = 76/82 (92.68%), Query Frame = 1
Query:   52 TVQEIRNAQRADGPATVLAIGTATPAHSANQADYPDYYFRITKSEHMTELKEKFRRMCDKSMIKKRHMHLTEEILKENPNMC 297
            TV+ IR AQRADGPA VLAIGTATPA+   QADYPDYYFRITKSEHMTELKEKF+RMCDKSMI+KR+MHLTE+ILKENPNMC
Sbjct:    5 TVEAIRKAQRADGPAAVLAIGTATPANYVTQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIRKRYMHLTEDILKENPNMC 86          
BLAST of FC876316 vs. ExPASy Swiss-Prot
Match: CHSY_ORYSJ (Chalcone synthase OS=Oryza sativa subsp. japonica GN=CHS PE=2 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 2.575e-35
Identity = 68/82 (82.93%), Postives = 76/82 (92.68%), Query Frame = 1
Query:   52 TVQEIRNAQRADGPATVLAIGTATPAHSANQADYPDYYFRITKSEHMTELKEKFRRMCDKSMIKKRHMHLTEEILKENPNMC 297
            TV+E+R AQRA+GPATVLAIGTATPA+   QADYPDYYFRITKSEHM ELKEKF+RMCDKS I+KR+MHLTEEIL+ENPNMC
Sbjct:    6 TVEEVRRAQRAEGPATVLAIGTATPANCVYQADYPDYYFRITKSEHMVELKEKFKRMCDKSQIRKRYMHLTEEILQENPNMC 87          
BLAST of FC876316 vs. ExPASy Swiss-Prot
Match: CHSY_ORYSI (Chalcone synthase OS=Oryza sativa subsp. indica GN=CHS PE=2 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 2.575e-35
Identity = 68/82 (82.93%), Postives = 76/82 (92.68%), Query Frame = 1
Query:   52 TVQEIRNAQRADGPATVLAIGTATPAHSANQADYPDYYFRITKSEHMTELKEKFRRMCDKSMIKKRHMHLTEEILKENPNMC 297
            TV+E+R AQRA+GPATVLAIGTATPA+   QADYPDYYFRITKSEHM ELKEKF+RMCDKS I+KR+MHLTEEIL+ENPNMC
Sbjct:    6 TVEEVRRAQRAEGPATVLAIGTATPANCVYQADYPDYYFRITKSEHMVELKEKFKRMCDKSQIRKRYMHLTEEILQENPNMC 87          
BLAST of FC876316 vs. ExPASy Swiss-Prot
Match: CHSY_BETVE (Chalcone synthase OS=Betula verrucosa GN=CHS PE=2 SV=2)

HSP 1 Score: 146.747 bits (369), Expect = 3.363e-35
Identity = 69/84 (82.14%), Postives = 77/84 (91.67%), Query Frame = 1
Query:   46 MATVQEIRNAQRADGPATVLAIGTATPAHSANQADYPDYYFRITKSEHMTELKEKFRRMCDKSMIKKRHMHLTEEILKENPNMC 297
            MA+V+EIR AQRA GPATVLAIGTATP++   QADYPDYYFRITKS+HMTELKEKF+RMCDKSMIKKR+M+L EEIL ENPNMC
Sbjct:    1 MASVEEIRKAQRAHGPATVLAIGTATPSNCITQADYPDYYFRITKSDHMTELKEKFKRMCDKSMIKKRYMYLNEEILNENPNMC 84          
BLAST of FC876316 vs. ExPASy Swiss-Prot
Match: CHSY_VITVI (Chalcone synthase OS=Vitis vinifera GN=CHS PE=2 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 4.392e-35
Identity = 69/84 (82.14%), Postives = 76/84 (90.48%), Query Frame = 1
Query:   46 MATVQEIRNAQRADGPATVLAIGTATPAHSANQADYPDYYFRITKSEHMTELKEKFRRMCDKSMIKKRHMHLTEEILKENPNMC 297
            M +V EIR AQRA+GPATVLAIGTATPA+   QADYPDYYFRIT SEHMTELKEKF+RMC+KSMI KR+MHLTEEILKENPN+C
Sbjct:    1 MVSVAEIRKAQRAEGPATVLAIGTATPANCVYQADYPDYYFRITNSEHMTELKEKFKRMCEKSMINKRYMHLTEEILKENPNVC 84          
The following BLAST results are available for this feature:
BLAST of FC876316 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 140
Match NameE-valueIdentityDescription
CHS2_CITSI1.410e-4195.24Chalcone synthase 2 OS=Citrus sinensis GN=CHS2 PE=... [more]
CHS3_RUTGR2.751e-3787.80Chalcone synthase 3 OS=Ruta graveolens GN=CHS3 PE=... [more]
CHSY_DIAMO6.129e-3783.33Chalcone synthase OS=Dianthus monspessulanus GN=CH... [more]
CHSY_DIACA3.042e-3682.14Chalcone synthase OS=Dianthus caryophyllus GN=CHS ... [more]
CHS2_RUTGR5.188e-3685.37Chalcone synthase 2 OS=Ruta graveolens GN=CHS2 PE=... [more]
CHS1_RUTGR5.188e-3685.37Chalcone synthase 1 OS=Ruta graveolens GN=CHS1 PE=... [more]
CHSY_ORYSJ2.575e-3582.93Chalcone synthase OS=Oryza sativa subsp. japonica ... [more]
CHSY_ORYSI2.575e-3582.93Chalcone synthase OS=Oryza sativa subsp. indica GN... [more]
CHSY_BETVE3.363e-3582.14Chalcone synthase OS=Betula verrucosa GN=CHS PE=2 ... [more]
CHSY_VITVI4.392e-3582.14Chalcone synthase OS=Vitis vinifera GN=CHS PE=2 SV... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32003C08EF DevOvary1 Citrus clementina cDNA clone C32003C08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876316 ID=FC876316|Name=FC876316|organism=Citrus clementina|type=EST|length=298bp
ACCAAGCACGAGCCACCCACATATTCATTAAGGGTTCAACTTGAAATGGC
AACCGTTCAAGAGATCAGAAACGCTCAGCGTGCCGACGGCCCGGCCACCG
TCCTCGCCATCGGTACGGCCACGCCTGCCCACAGTGCCAACCAGGCTGAT
TATCCCGACTATTACTTCAGGATCACAAAGAGCGAGCATATGACGGAGCT
TAAAGAGAAGTTCAGGCGCATGTGTGACAAGTCGATGATTAAGAAGCGCC
ACATGCACTTAACGGAAGAGATTTTGAAGGAAAACCCCAACATGTGCG
back to top