FC876322

Overview
NameFC876322
Unique NameFC876322
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length651
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9403 contig Ccv1_Contig9403:559..1209. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876322 vs. ExPASy Swiss-Prot
Match: Y2168_ARATH (Ankyrin repeat-containing protein At2g01680 OS=Arabidopsis thaliana GN=At2g01680 PE=1 SV=1)

HSP 1 Score: 321.627 bits (823), Expect = 2.183e-87
Identity = 159/217 (73.27%), Postives = 186/217 (85.71%), Query Frame = 1
Query:    1 ELCKSCDSSNTSPLYSAAVQDHLDVVNTILDADVSCTRIVRKNGKTALHTAARYGLINIVTALIVRDPEIVTIKDKKGQTALHMAVKGQCPSVVEDILSADHLILNERDKKGNTAVHIATRKCRPQIVSLLLSYTSIDVNAINNQRETAMDLADKLQYGDSTLEIKEALAEAGAKHARYVGQVDEAMELKRTVSDIKHEVSAQLIPNEKTHRRVSGI 651
            ELC+ CD+SNTSPLY+AAVQDHL++VN +LD D SC  IVRKNGKT+LHTA RYGL+ IV ALI +D  IV +KDKKGQTALHMAVKG+   VVE+IL AD+ ILNERD+KGNTA+HIATRK RPQI SLLL++T+I+VNAINNQ+ETAMDLADKLQY +S LEI EAL EAGAKH R++G+ DEA  LKR VSDIKHEV +QL+ NEKT+RRVSGI
Sbjct:  119 ELCRICDASNTSPLYAAAVQDHLEIVNAMLDVDPSCAMIVRKNGKTSLHTAGRYGLLRIVKALIEKDAAIVGVKDKKGQTALHMAVKGRSLEVVEEILQADYTILNERDRKGNTALHIATRKARPQITSLLLTFTAIEVNAINNQKETAMDLADKLQYSESALEINEALVEAGAKHGRFIGREDEARALKRAVSDIKHEVQSQLLQNEKTNRRVSGI 335          
BLAST of FC876322 vs. ExPASy Swiss-Prot
Match: Y3236_ARATH (Ankyrin repeat-containing protein At3g12360 OS=Arabidopsis thaliana GN=At3g12360 PE=2 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 8.988e-41
Identity = 93/216 (43.06%), Postives = 134/216 (62.04%), Query Frame = 1
Query:    4 LCKSCDSSNTSPLYSAAVQDHLDVVNTILDADVSCTRIVRKNGKTALHTAARYGLINIVTALIVRDPEIVTIKDKKGQTALHMAVKGQCPSVVEDILSADHLILNERDKKGNTAVHIATRKCRPQIVSLLLSYTSIDVNAINNQRETAMDLADKLQYGDSTLEIKEALAEAGAKHARYVGQVDEAMELKRTVSDIKHEVSAQLIPNEKTHRRVSGI 651
            L ++   SN +PL SAA++ H +VVN +L    +   I R N K ALH AAR G + ++ AL+ +DP++    DKKGQTALHMAVKGQ   VV+ +L AD  I+ + DK  NTA+H+ATRK R +IV LLLS    + N +    +TA+D+A+ L   + +  IKE LA +GA  A  + Q  +  EL+ TV+ IK++V  QL   ++T++ V  I
Sbjct:  190 LSQTFGPSNATPLVSAAMRGHTEVVNQLLSKAGNLLEISRSNNKNALHLAARQGHVEVIKALLSKDPQLARRIDKKGQTALHMAVKGQSSEVVKLLLDADPAIVMQPDKSCNTALHVATRKKRAEIVELLLSLPDTNANTLTRDHKTALDIAEGLPLSEESSYIKECLARSGALRANELNQPRD--ELRSTVTQIKNDVHIQLEQTKRTNKNVHNI 403          
BLAST of FC876322 vs. ExPASy Swiss-Prot
Match: Y5262_ARATH (Ankyrin repeat-containing protein At5g02620 OS=Arabidopsis thaliana GN=At5g02620 PE=1 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 2.891e-39
Identity = 97/223 (43.50%), Postives = 132/223 (59.19%), Query Frame = 1
Query:    1 ELCKSCDSSNTSPLYSAAVQDHLDVVNTILDADVSCTRIVRKNGKTALHTAARYGLINIVTALIVRDPEIVTIKDKKGQTALHMAVKGQCPSVVEDILSADHLILNERDKKGNTAVHIATRKCRPQIVSLLLSYTSIDVNAINNQRETAMDLADKLQYGDSTLEIKEALAEAGAKHARYVGQVDE------AMELKRTVSDIKHEVSAQLIPNEKTHRRVSGI 651
            EL  + DSS T+ L++AA Q H ++V  +LD  V    I R NGKTALH+AAR G   IV  LI +   +VT  DKKGQTALHMAVKGQ   +V+ ++ AD  ++N  D KGNT +HIA RK R +IV  +L Y  +   A+N   ETA+D+A+K        EI   L + G ++AR +   ++      + +LK TVS+I HEV  QL    +T R + GI
Sbjct:  116 ELSFTFDSSKTTALHTAASQGHGEIVCFLLDKGVDLAAIARSNGKTALHSAARNGHTVIVKKLIEKKAGMVTRVDKKGQTALHMAVKGQNTEIVDVLMEADGSLINSADNKGNTPLHIAVRKNRAEIVQTVLKYCEVSRVAVNKSGETALDIAEK----TGLHEIVPLLQKIGMQNARSIKPAEKVEPSGSSRKLKETVSEIGHEVHTQLEQTGRTRREIQGI 334          
BLAST of FC876322 vs. ExPASy Swiss-Prot
Match: Y317_RICBR (Putative ankyrin repeat protein RBE_0317 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0317 PE=4 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 5.491e-14
Identity = 45/114 (39.47%), Postives = 63/114 (55.26%), Query Frame = 1
Query:  124 KNGKTALHTAARYGLINIVTALIVRDPEIVTIKDKKGQTALHMAVKGQCPSVVEDILSADHLILNERDKKGNTAVHIATRKCRPQIVSLLLSYTSIDVNAINNQRETAMDLADK 465
            KNG T LH A   G   +V  L       V  KD  G + LH+A+K   P +VE +LS +++ +NE+DK G+T +H A R    +I+ +LL    IDVN  +NQ ET +  A K
Sbjct:   92 KNGNTLLHAAIDQGKSEVVKFLTSYKNLEVNTKDLGGNSPLHLAIKSNNPEIVEMLLSYENINVNEKDKYGDTTLHKAIRSYNHKIIEMLLLREEIDVNEKDNQGETPLHGAVK 205          
BLAST of FC876322 vs. ExPASy Swiss-Prot
Match: ANR44_MOUSE (Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.353e-12
Identity = 54/159 (33.96%), Postives = 84/159 (52.83%), Query Frame = 1
Query:   19 DSSNTSPLYSAAVQDHLDVVNTILDADVSCTRIVRKNGKTALHTAARYGLINIVTALIVRDPEIVTIKDKKGQTALHMAVKGQCPSVVEDILSADHLILNERDKKGNTAVHIATRKCRPQIVSLLLSYTSIDVNAINNQRETAMDLADKLQYGDSTLEI 495
            D    + L+ AA+  H+++VN +L    +     +K+ + ALH AA  G +++V  LI    E VT KDKKG T LH A      SVV+ +L+   + ++E +  GNTA+HIA    +  +V+ L+ Y   +VN  NN   T +  A    +G   LE+
Sbjct:  137 DRGGRTALHHAALNGHMEMVNLLLAKGANINAFDKKD-RRALHWAAYMGHLDVVALLINHGAE-VTCKDKKGYTPLHAAASNGQISVVKHLLNLG-VEIDEINVYGNTALHIACYNGQDAVVNELIDY-GANVNQPNNSGFTPLHFAAASTHGALCLEL 291          
BLAST of FC876322 vs. ExPASy Swiss-Prot
Match: ANR44_HUMAN (Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3)

HSP 1 Score: 71.633 bits (174), Expect = 3.935e-12
Identity = 53/159 (33.33%), Postives = 84/159 (52.83%), Query Frame = 1
Query:   19 DSSNTSPLYSAAVQDHLDVVNTILDADVSCTRIVRKNGKTALHTAARYGLINIVTALIVRDPEIVTIKDKKGQTALHMAVKGQCPSVVEDILSADHLILNERDKKGNTAVHIATRKCRPQIVSLLLSYTSIDVNAINNQRETAMDLADKLQYGDSTLEI 495
            D    + L+ AA+  H+++VN +L    +     +K+ + ALH AA  G +++V  LI    E VT KDKKG T LH A      +VV+ +L+   + ++E +  GNTA+HIA    +  +V+ L+ Y   +VN  NN   T +  A    +G   LE+
Sbjct:  137 DRGGRTALHHAALNGHVEMVNLLLAKGANINAFDKKD-RRALHWAAYMGHLDVVALLINHGAE-VTCKDKKGYTPLHAAASNGQINVVKHLLNLG-VEIDEINVYGNTALHIACYNGQDAVVNELIDY-GANVNQPNNNGFTPLHFAAASTHGALCLEL 291          
BLAST of FC876322 vs. ExPASy Swiss-Prot
Match: ANR44_CHICK (Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 3.935e-12
Identity = 52/159 (32.70%), Postives = 83/159 (52.20%), Query Frame = 1
Query:   19 DSSNTSPLYSAAVQDHLDVVNTILDADVSCTRIVRKNGKTALHTAARYGLINIVTALIVRDPEIVTIKDKKGQTALHMAVKGQCPSVVEDILSADHLILNERDKKGNTAVHIATRKCRPQIVSLLLSYTSIDVNAINNQRETAMDLADKLQYGDSTLEI 495
            D    + L+ AA+  H+++VN +L    +     +K+ + ALH AA  G + +V  LI    E VT KDKKG T LH A      ++V+ +L+   + ++E +  GNTA+HIA    +  +V+ L+ Y   +VN  NN   T +  A    +G   LE+
Sbjct:  137 DRGGRTALHHAALNGHVEMVNLLLAKGANINAFDKKD-RRALHWAAYMGHLEVVALLINHGAE-VTCKDKKGYTPLHAAASNGQINIVKHLLNLG-VEIDEMNIYGNTALHIACYNGQDSVVNELIDY-GANVNQPNNNGFTPLHFAAASTHGALCLEL 291          
BLAST of FC876322 vs. ExPASy Swiss-Prot
Match: UACA_MOUSE (Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Mus musculus GN=Uaca PE=1 SV=2)

HSP 1 Score: 70.4774 bits (171), Expect = 8.767e-12
Identity = 61/200 (30.50%), Postives = 97/200 (48.50%), Query Frame = 1
Query:   19 DSSNTSPLYSAAVQDHLDVVNTILDADVS-CTRIVRKNGKTALHTAARYGLINIVTALIVRDPEIVTIKDKKGQTALHMAVKGQCPSVVEDILSADH-LILNERDKKGNTAVHIATRKCRPQIVSLLLSYTSIDVNAINNQRETAM---------DLADKLQYGDSTLEIKEALAEAGAKHARYVGQVDEAMELKRTVSD 585
            D    S  +  A + +L+ +N IL   +   TR     G+ ALH AA+YG    +  L+  +     + D +G+TALH AV   CPS ++  L  DH   +N +D  G T + +AT+ CRP I  LL+     DVN+ + Q  TA+         D  + L    + L + +AL    + +AR +G   + + L +T S+
Sbjct:   67 DVEGRSAFHVVASKGNLECLNAILTHGIDVATR--DSAGRNALHLAAKYGHALCLQKLLQYNCPTEHV-DLQGRTALHDAVMADCPSSIQ--LLCDHGASVNAKDIDGRTPLVLATQMCRPTICQLLID-RGADVNSRDKQNRTALMLGCEYGCRDAVEVLVKNGADLTLLDALGHDSSYYAR-IGDNLDILNLLKTASE 259          
BLAST of FC876322 vs. ExPASy Swiss-Prot
Match: ANKR1_PIG (Ankyrin repeat domain-containing protein 1 OS=Sus scrofa GN=ANKRD1 PE=2 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 1.953e-11
Identity = 52/174 (29.89%), Postives = 97/174 (55.75%), Query Frame = 1
Query:   16 CDSSNTSPLYSAAVQDHLDVVNTILDADVSCT-RIVRKNGKTALHTAARYGLINIVTALIVRDPEIVTIKDKKGQTALHMAVKGQCPSVVEDILSADHLILNERDKKGNTAVHIATRKCRPQIVSLLLSYTSIDVNAINNQRETAMDLADKLQYGDSTLEIKEALAEAGAKHAR 534
            CD    + L+ A ++ HL +V  +++A      R + ++  TA+H A+R G ++++  L+ +  +I + +DK   TALH+AV+       E +++ +   LN +D++G+T +H A R  R +++ LL++Y   D+N  N   +T MDL   L + + T  I ++L E   K +R
Sbjct:  149 CDEYKRTALHRACLEGHLAIVEKLIEAGAQIEFRDMLES--TAIHWASRGGNLDVLKLLLNKGAKI-SARDKLLSTALHVAVRTGHYECAEHLIACE-ADLNAKDREGDTPLHDAVRLNRYKMIRLLITY-GADLNVKNCAGKTPMDLV--LNWQNGTKAIFDSLKENSYKASR 315          
BLAST of FC876322 vs. ExPASy Swiss-Prot
Match: ANKR1_RAT (Ankyrin repeat domain-containing protein 1 OS=Rattus norvegicus GN=Ankrd1 PE=1 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 3.331e-11
Identity = 51/174 (29.31%), Postives = 97/174 (55.75%), Query Frame = 1
Query:   16 CDSSNTSPLYSAAVQDHLDVVNTILDADVSCT-RIVRKNGKTALHTAARYGLINIVTALIVRDPEIVTIKDKKGQTALHMAVKGQCPSVVEDILSADHLILNERDKKGNTAVHIATRKCRPQIVSLLLSYTSIDVNAINNQRETAMDLADKLQYGDSTLEIKEALAEAGAKHAR 534
            CD    + L+ A ++ HL +V  +++A      R + ++  TA+H A R G ++++  L+ +  +I + +DK   TALH+AV+       E +++ +   LN +D++G+T +H A R  R +++ LL+++   D+N  N   +T MDL   L + + T  I ++L E   K++R
Sbjct:  149 CDEYKRTALHRACLEGHLAIVEKLMEAGAQIEFRDMLES--TAIHWACRGGNLDVLKLLLNKGAKI-SARDKLLSTALHVAVRTGHYECAEHLIACE-ADLNAKDREGDTPLHDAVRLNRYKMIRLLMTF-GADLNVKNCAGKTPMDLV--LHWQNGTKAIFDSLKENAYKNSR 315          
The following BLAST results are available for this feature:
BLAST of FC876322 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 13
Match NameE-valueIdentityDescription
Y2168_ARATH2.183e-8773.27Ankyrin repeat-containing protein At2g01680 OS=Ara... [more]
Y3236_ARATH8.988e-4143.06Ankyrin repeat-containing protein At3g12360 OS=Ara... [more]
Y5262_ARATH2.891e-3943.50Ankyrin repeat-containing protein At5g02620 OS=Ara... [more]
Y317_RICBR5.491e-1439.47Putative ankyrin repeat protein RBE_0317 OS=Ricket... [more]
ANR44_MOUSE1.353e-1233.96Serine/threonine-protein phosphatase 6 regulatory ... [more]
ANR44_HUMAN3.935e-1233.33Serine/threonine-protein phosphatase 6 regulatory ... [more]
ANR44_CHICK3.935e-1232.70Serine/threonine-protein phosphatase 6 regulatory ... [more]
UACA_MOUSE8.767e-1230.50Uveal autoantigen with coiled-coil domains and ank... [more]
ANKR1_PIG1.953e-1129.89Ankyrin repeat domain-containing protein 1 OS=Sus ... [more]
ANKR1_RAT3.331e-1129.31Ankyrin repeat domain-containing protein 1 OS=Ratt... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32003D04EF DevOvary1 Citrus clementina cDNA clone C32003D04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876322 ID=FC876322|Name=FC876322|organism=Citrus clementina|type=EST|length=651bp
GAGCTATGTAAGTCCTGTGACTCCTCAAATACTAGCCCACTTTATTCGGC
AGCTGTGCAAGATCATTTGGATGTGGTGAATACCATCTTGGATGCTGATG
TCAGCTGCACGAGAATAGTTAGAAAAAATGGAAAAACAGCGCTGCATACT
GCTGCAAGGTATGGTCTCATTAATATAGTTACAGCTCTTATAGTCCGGGA
TCCAGAAATTGTCACAATTAAAGATAAGAAAGGTCAAACTGCACTCCATA
TGGCTGTAAAGGGTCAGTGTCCTTCAGTGGTAGAGGATATATTATCTGCT
GATCATTTAATACTAAATGAGCGCGACAAGAAGGGCAATACAGCGGTGCA
TATAGCTACAAGGAAATGCCGTCCTCAGATAGTATCCCTATTGCTAAGTT
ATACATCCATTGATGTCAACGCCATCAATAATCAGCGAGAAACTGCAATG
GATTTAGCAGACAAACTCCAGTATGGAGATTCTACACTGGAAATTAAGGA
AGCTCTTGCAGAGGCTGGTGCCAAGCATGCAAGATATGTTGGCCAGGTTG
ATGAAGCAATGGAACTTAAGAGGACTGTGAGTGACATTAAGCATGAAGTT
AGTGCACAACTCATACCAAATGAAAAAACCCACAGAAGAGTTTCTGGCAT
C
back to top