FC876329

Overview
NameFC876329
Unique NameFC876329
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length327
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10260 contig Ccv1_Contig10260:33..359. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876329 vs. ExPASy Swiss-Prot
Match: CHS2_CITSI (Chalcone synthase 2 OS=Citrus sinensis GN=CHS2 PE=2 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 1.194e-48
Identity = 94/98 (95.92%), Postives = 94/98 (95.92%), Query Frame = 2
Query:   26 MATVQEIRNAQ*ADGPATVLGIGTDTPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMDPSLDARQDIV 319
            MATVQEIRNAQ ADGPATVL IGT TPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYM PSLDARQDIV
Sbjct:    1 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIV 98          
BLAST of FC876329 vs. ExPASy Swiss-Prot
Match: CHS3_RUTGR (Chalcone synthase 3 OS=Ruta graveolens GN=CHS3 PE=2 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 4.396e-43
Identity = 84/96 (87.50%), Postives = 89/96 (92.71%), Query Frame = 2
Query:   32 TVQEIRNAQ*ADGPATVLGIGTDTPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMDPSLDARQDIV 319
            TV+EIR AQ ADGPATVL IGT TPA+ V QADYPDYYFRITKSEHMT+LKEKFKRMCDKSMI+KRYM+LTEEILKENPNMCAYM PSLDARQDIV
Sbjct:    5 TVEEIRKAQRADGPATVLAIGTATPANYVTQADYPDYYFRITKSEHMTDLKEKFKRMCDKSMIRKRYMHLTEEILKENPNMCAYMAPSLDARQDIV 100          
BLAST of FC876329 vs. ExPASy Swiss-Prot
Match: CHS2_RUTGR (Chalcone synthase 2 OS=Ruta graveolens GN=CHS2 PE=2 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 4.396e-43
Identity = 84/96 (87.50%), Postives = 88/96 (91.67%), Query Frame = 2
Query:   32 TVQEIRNAQ*ADGPATVLGIGTDTPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMDPSLDARQDIV 319
            TV+EIR AQ ADGPA VL IGT TPA+ V QADYPDYYFRITKSEHMTELKEKFKRMCDKSMI+KRYMYLTE+ILKENPNMCAYM PSLDARQDIV
Sbjct:    5 TVEEIRKAQRADGPAAVLAIGTATPANYVTQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIRKRYMYLTEDILKENPNMCAYMAPSLDARQDIV 100          
BLAST of FC876329 vs. ExPASy Swiss-Prot
Match: CHS1_RUTGR (Chalcone synthase 1 OS=Ruta graveolens GN=CHS1 PE=2 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 8.290e-42
Identity = 82/96 (85.42%), Postives = 87/96 (90.62%), Query Frame = 2
Query:   32 TVQEIRNAQ*ADGPATVLGIGTDTPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMDPSLDARQDIV 319
            TV+ IR AQ ADGPA VL IGT TPA+ V QADYPDYYFRITKSEHMTELKEKFKRMCDKSMI+KRYM+LTE+ILKENPNMCAYM PSLDARQDIV
Sbjct:    5 TVEAIRKAQRADGPAAVLAIGTATPANYVTQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIRKRYMHLTEDILKENPNMCAYMAPSLDARQDIV 100          
BLAST of FC876329 vs. ExPASy Swiss-Prot
Match: CHSY_BETVE (Chalcone synthase OS=Betula verrucosa GN=CHS PE=2 SV=2)

HSP 1 Score: 167.548 bits (423), Expect = 1.847e-41
Identity = 81/98 (82.65%), Postives = 87/98 (88.78%), Query Frame = 2
Query:   26 MATVQEIRNAQ*ADGPATVLGIGTDTPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMDPSLDARQDIV 319
            MA+V+EIR AQ A GPATVL IGT TP++ + QADYPDYYFRITKS+HMTELKEKFKRMCDKSMIKKRYMYL EEIL ENPNMCAYM PSLDARQ IV
Sbjct:    1 MASVEEIRKAQRAHGPATVLAIGTATPSNCITQADYPDYYFRITKSDHMTELKEKFKRMCDKSMIKKRYMYLNEEILNENPNMCAYMAPSLDARQTIV 98          
BLAST of FC876329 vs. ExPASy Swiss-Prot
Match: CHSY_ORYSJ (Chalcone synthase OS=Oryza sativa subsp. japonica GN=CHS PE=2 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 4.115e-41
Identity = 80/96 (83.33%), Postives = 87/96 (90.62%), Query Frame = 2
Query:   32 TVQEIRNAQ*ADGPATVLGIGTDTPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMDPSLDARQDIV 319
            TV+E+R AQ A+GPATVL IGT TPA+ V QADYPDYYFRITKSEHM ELKEKFKRMCDKS I+KRYM+LTEEIL+ENPNMCAYM PSLDARQDIV
Sbjct:    6 TVEEVRRAQRAEGPATVLAIGTATPANCVYQADYPDYYFRITKSEHMVELKEKFKRMCDKSQIRKRYMHLTEEILQENPNMCAYMAPSLDARQDIV 101          
BLAST of FC876329 vs. ExPASy Swiss-Prot
Match: CHSY_ORYSI (Chalcone synthase OS=Oryza sativa subsp. indica GN=CHS PE=2 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 4.115e-41
Identity = 80/96 (83.33%), Postives = 87/96 (90.62%), Query Frame = 2
Query:   32 TVQEIRNAQ*ADGPATVLGIGTDTPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMDPSLDARQDIV 319
            TV+E+R AQ A+GPATVL IGT TPA+ V QADYPDYYFRITKSEHM ELKEKFKRMCDKS I+KRYM+LTEEIL+ENPNMCAYM PSLDARQDIV
Sbjct:    6 TVEEVRRAQRAEGPATVLAIGTATPANCVYQADYPDYYFRITKSEHMVELKEKFKRMCDKSQIRKRYMHLTEEILQENPNMCAYMAPSLDARQDIV 101          
BLAST of FC876329 vs. ExPASy Swiss-Prot
Match: CHSY_DIAMO (Chalcone synthase OS=Dianthus monspessulanus GN=CHS PE=2 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 4.115e-41
Identity = 77/98 (78.57%), Postives = 88/98 (89.80%), Query Frame = 2
Query:   26 MATVQEIRNAQ*ADGPATVLGIGTDTPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMDPSLDARQDIV 319
            MA+++EIR AQ ADGPAT+L IGT TP +++ QADYPDYYFR+TKSEHMTELKEKF+RMCDKSMIKKRYMYLTEEILKENPN+C YM  SLD RQD+V
Sbjct:    1 MASIEEIRQAQRADGPATILAIGTATPPNAIYQADYPDYYFRVTKSEHMTELKEKFRRMCDKSMIKKRYMYLTEEILKENPNLCEYMGSSLDTRQDMV 98          
BLAST of FC876329 vs. ExPASy Swiss-Prot
Match: CHSB_SOLTU (Chalcone synthase 1B OS=Solanum tuberosum GN=CHS1B PE=2 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 7.018e-41
Identity = 79/98 (80.61%), Postives = 87/98 (88.78%), Query Frame = 2
Query:   26 MATVQEIRNAQ*ADGPATVLGIGTDTPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMDPSLDARQDIV 319
            M TV+E R AQ A+GPAT+L IGT TP++ V+Q+ YPDYYFRIT SEH TELKEKFKRMCDKSMIKKRYM+LTEEILKENPNMCAYM PSLDARQDIV
Sbjct:    1 MVTVEEYRKAQRAEGPATILAIGTSTPSNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCDKSMIKKRYMHLTEEILKENPNMCAYMAPSLDARQDIV 98          
BLAST of FC876329 vs. ExPASy Swiss-Prot
Match: CHSA_SOLTU (Chalcone synthase 1A OS=Solanum tuberosum GN=CHS1A PE=2 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 7.018e-41
Identity = 79/98 (80.61%), Postives = 87/98 (88.78%), Query Frame = 2
Query:   26 MATVQEIRNAQ*ADGPATVLGIGTDTPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMDPSLDARQDIV 319
            M TV+E R AQ A+GPAT+L IGT TP++ V+Q+ YPDYYFRIT SEH TELKEKFKRMCDKSMIKKRYM+LTEEILKENPNMCAYM PSLDARQDIV
Sbjct:    1 MVTVEEYRKAQRAEGPATILAIGTSTPSNCVDQSTYPDYYFRITNSEHKTELKEKFKRMCDKSMIKKRYMHLTEEILKENPNMCAYMAPSLDARQDIV 98          
The following BLAST results are available for this feature:
BLAST of FC876329 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 140
Match NameE-valueIdentityDescription
CHS2_CITSI1.194e-4895.92Chalcone synthase 2 OS=Citrus sinensis GN=CHS2 PE=... [more]
CHS3_RUTGR4.396e-4387.50Chalcone synthase 3 OS=Ruta graveolens GN=CHS3 PE=... [more]
CHS2_RUTGR4.396e-4387.50Chalcone synthase 2 OS=Ruta graveolens GN=CHS2 PE=... [more]
CHS1_RUTGR8.290e-4285.42Chalcone synthase 1 OS=Ruta graveolens GN=CHS1 PE=... [more]
CHSY_BETVE1.847e-4182.65Chalcone synthase OS=Betula verrucosa GN=CHS PE=2 ... [more]
CHSY_ORYSJ4.115e-4183.33Chalcone synthase OS=Oryza sativa subsp. japonica ... [more]
CHSY_ORYSI4.115e-4183.33Chalcone synthase OS=Oryza sativa subsp. indica GN... [more]
CHSY_DIAMO4.115e-4178.57Chalcone synthase OS=Dianthus monspessulanus GN=CH... [more]
CHSB_SOLTU7.018e-4180.61Chalcone synthase 1B OS=Solanum tuberosum GN=CHS1B... [more]
CHSA_SOLTU7.018e-4180.61Chalcone synthase 1A OS=Solanum tuberosum GN=CHS1A... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32003D12EF DevOvary1 Citrus clementina cDNA clone C32003D12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876329 ID=FC876329|Name=FC876329|organism=Citrus clementina|type=EST|length=327bp
ATATTCATTAAGGGTTCAACTTGAAATGGCTACCGTTCAAGAGATCAGAA
ACGCTCAGTGAGCCGACGGTCCGGCCACCGTCCTCGGCATCGGTACGGAC
ACGCCTGCCCACAGTGTCAACCAAGCTGATTATCCCGACTATTACTTCAG
GATCACAAAGAGCGAGCATATGACGGAGCTTAAAGAGAAGTTCAAGCGCA
TGTGTGACAAGTCGATGATTAAGAAGCGTTACATGTACTTAACGGAAGAG
ATTTTGAAGGAAAACCCCAACATGTGCGCTTACATGGATCCATCACTCGA
CGCACGTCAAGACATTGTGGCGGGCGA
back to top