FC876330

Overview
NameFC876330
Unique NameFC876330
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length634
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig160 contig Ccv1_Contig160:13..647. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC876330 vs. ExPASy Swiss-Prot
Match: CHID_SOLLC (Basic endochitinase (Fragment) OS=Solanum lycopersicum GN=CHI14 PE=2 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.449e-20
Identity = 41/104 (39.42%), Postives = 52/104 (50.00%), Query Frame = 2
Query:  230 NETISDYFQVYQFENFFSKRNTPVAHAVGFWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMSPSQSYCDDS 541
            ++ IS       FE     RN     A GF+ Y++FITAT  +    FGTTG    + KEI AFLA    +T+ G+  A  GP +WG CYN E      YC  S
Sbjct:    2 SQNISSLISKNLFERILVHRNDRACGAKGFYTYEAFITATKTFA--AFGTTGDTNTRNKEIAAFLAQTSHETTGGWATAPDGPYSWGYCYNREQGSPGDYCASS 103          

HSP 2 Score: 43.1282 bits (100), Expect = 1.449e-20
Identity = 16/27 (59.26%), Postives = 20/27 (74.07%), Query Frame = 1
Query:  553 YPCTPGAEYYARGAIPIYWNYNYGATG 633
            +PC PG +Y+ RG I I +NYNYGA G
Sbjct:  106 WPCAPGKKYFGRGPIQISYNYNYGAAG 132          
BLAST of FC876330 vs. ExPASy Swiss-Prot
Match: CHIB_ARATH (Basic endochitinase B OS=Arabidopsis thaliana GN=CHI-B PE=1 SV=3)

HSP 1 Score: 77.411 bits (189), Expect = 1.870e-20
Identity = 35/93 (37.63%), Postives = 50/93 (53.76%), Query Frame = 2
Query:  263 QFENFFSKRNTPVAHAVGFWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMSPSQSYCDDS 541
            QF++    RN     A GF+ Y +FITA   +   GFGTTG    + KE+ AF      +T+ G+  A  GP +WG C+  E +P+  YC+ S
Sbjct:   94 QFDDMLKHRNDAACPARGFYTYNAFITAAKSFP--GFGTTGDTATRKKEVAAFFGQTSHETTGGWATAPDGPYSWGYCFKQEQNPASDYCEPS 184          

HSP 2 Score: 42.3578 bits (98), Expect = 1.870e-20
Identity = 15/28 (53.57%), Postives = 18/28 (64.29%), Query Frame = 1
Query:  550 TYPCTPGAEYYARGAIPIYWNYNYGATG 633
            T+PC  G  YY RG + + WNYNYG  G
Sbjct:  186 TWPCASGKRYYGRGPMQLSWNYNYGLCG 213          
BLAST of FC876330 vs. ExPASy Swiss-Prot
Match: CHI2_BRANA (Endochitinase CH25 OS=Brassica napus PE=2 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.533e-19
Identity = 36/93 (38.71%), Postives = 49/93 (52.69%), Query Frame = 2
Query:  263 QFENFFSKRNTPVAHAVGFWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMSPSQSYCDDS 541
            QF++    RN     A GF+ Y +FI A   +   GFGTTG    + KEI AF      +T+ G+  A  GP +WG C+  E +PS +YC  S
Sbjct:   79 QFDDMLKHRNDNACPARGFYTYDAFINAAKSFP--GFGTTGDTATRKKEIAAFFGQTSHETTGGWATAPDGPYSWGYCFKQEQNPSSNYCSPS 169          

HSP 2 Score: 40.4318 bits (93), Expect = 1.533e-19
Identity = 14/27 (51.85%), Postives = 17/27 (62.96%), Query Frame = 1
Query:  553 YPCTPGAEYYARGAIPIYWNYNYGATG 633
            +PC  G  YY RG + + WNYNYG  G
Sbjct:  172 WPCASGKSYYGRGPMQLSWNYNYGQCG 198          
BLAST of FC876330 vs. ExPASy Swiss-Prot
Match: CHIT_CARPA (Endochitinase OS=Carica papaya PE=1 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 2.009e-19
Identity = 34/92 (36.96%), Postives = 49/92 (53.26%), Query Frame = 2
Query:  266 FENFFSKRNTPVAHAVGFWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMSPSQSYCDDS 541
            F+     RN P   A GF+ Y +F+ A   +    FGTTG+   + +E+ AFL     +T+ G+  A  GP AWG C+  E +PS +YC  S
Sbjct:   11 FDQMLKHRNNPACPAKGFYTYDAFLAAAKSFP--SFGTTGSTDVRKRELAAFLGQTSHETTGGWPSAPDGPYAWGYCFLKERNPSSNYCAPS 100          

HSP 2 Score: 45.8246 bits (107), Expect = 2.009e-19
Identity = 16/27 (59.26%), Postives = 18/27 (66.67%), Query Frame = 1
Query:  553 YPCTPGAEYYARGAIPIYWNYNYGATG 633
            YPC PG  YY RG + + WNYNYG  G
Sbjct:  103 YPCAPGKSYYGRGPLQLSWNYNYGPCG 129          
BLAST of FC876330 vs. ExPASy Swiss-Prot
Match: CHI1_GOSHI (Endochitinase 1 OS=Gossypium hirsutum PE=3 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 4.385e-19
Identity = 38/95 (40.00%), Postives = 48/95 (50.53%), Query Frame = 2
Query:  266 FENFFSKRNTPVAHAVGFWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYG-VATGGPLAWGLCYNHEMSPSQSYCDDSYN 547
            F      RN     A GF+ Y +FI A   +    F TTG +  + +EI AFLA    +T+ G G  A  GP AWG CYN E++P  SYC    N
Sbjct:   83 FNQMLLHRNDGACPARGFYTYDAFIAAARSFP--AFATTGDQATRKREIAAFLAQTSHETTGGAGWAAPDGPYAWGYCYNRELNPPSSYCASDPN 175          

HSP 2 Score: 44.669 bits (104), Expect = 4.385e-19
Identity = 15/27 (55.56%), Postives = 19/27 (70.37%), Query Frame = 1
Query:  553 YPCTPGAEYYARGAIPIYWNYNYGATG 633
            YPC PG +Y+ RG + + WNYNYG  G
Sbjct:  176 YPCAPGKQYFGRGPMQLSWNYNYGQCG 202          
BLAST of FC876330 vs. ExPASy Swiss-Prot
Match: CHI2_GOSHI (Endochitinase 2 (Fragment) OS=Gossypium hirsutum PE=2 SV=2)

HSP 1 Score: 70.4774 bits (171), Expect = 4.392e-19
Identity = 38/95 (40.00%), Postives = 48/95 (50.53%), Query Frame = 2
Query:  266 FENFFSKRNTPVAHAVGFWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYG-VATGGPLAWGLCYNHEMSPSQSYCDDSYN 547
            F      RN     A GF+ Y +FI A   +    F TTG +  + +EI AFLA    +T+ G G  A  GP AWG CYN E++P  SYC    N
Sbjct:   61 FNQMLLHRNDGACPARGFYTYDAFIAAARSFP--AFATTGDQATRKREIAAFLAQTSHETTGGAGWAAPDGPYAWGYCYNRELNPPSSYCASDPN 153          

HSP 2 Score: 44.669 bits (104), Expect = 4.392e-19
Identity = 15/27 (55.56%), Postives = 19/27 (70.37%), Query Frame = 1
Query:  553 YPCTPGAEYYARGAIPIYWNYNYGATG 633
            YPC PG +Y+ RG + + WNYNYG  G
Sbjct:  154 YPCAPGKQYFGRGPMQLSWNYNYGQCG 180          
BLAST of FC876330 vs. ExPASy Swiss-Prot
Match: CHI10_ORYSJ (Chitinase 10 OS=Oryza sativa subsp. japonica GN=Cht10 PE=2 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 1.257e-18
Identity = 33/90 (36.67%), Postives = 50/90 (55.56%), Query Frame = 2
Query:  266 FENFFSKRNTPVAHAVGFWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMSPSQSYCD 535
            + + F  ++     A GF+ Y SF+ A  ++    F  TG    + +E+ AFLA +  +T+ G+  A  GP AWGLCY  E++P  SYCD
Sbjct:   58 YASLFLHKDDAACPARGFYTYASFVRAATRFPR--FAATGCADARKREVAAFLAQISHETTGGWATAPDGPYAWGLCYKEEINPQSSYCD 145          

HSP 2 Score: 41.5874 bits (96), Expect = 1.257e-18
Identity = 15/27 (55.56%), Postives = 18/27 (66.67%), Query Frame = 1
Query:  553 YPCTPGAEYYARGAIPIYWNYNYGATG 633
            +PC PG  Y+ RG I I WN+NYG  G
Sbjct:  151 WPCYPGKSYHGRGPIQISWNFNYGPAG 177          
BLAST of FC876330 vs. ExPASy Swiss-Prot
Match: CHIT_PHAVU (Endochitinase OS=Phaseolus vulgaris PE=1 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 3.583e-18
Identity = 34/89 (38.20%), Postives = 45/89 (50.56%), Query Frame = 2
Query:  266 FENFFSKRNTPVAHAVGFWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMSPSQSYC 532
            F+     RN     A GF+ Y +FI A   Y    FG TG    + +EI AFL     +T+ G+  A  GP AWG C+  E +PS +YC
Sbjct:   85 FDQMLKHRNDGACPAKGFYTYDAFIAAAKAYP--SFGNTGDTATRKREIAAFLGQTSHETTGGWATAPDGPYAWGYCFVRERNPS-TYC 170          

HSP 2 Score: 46.595 bits (109), Expect = 3.583e-18
Identity = 17/27 (62.96%), Postives = 19/27 (70.37%), Query Frame = 1
Query:  553 YPCTPGAEYYARGAIPIYWNYNYGATG 633
            +PC PG +YY RG I I WNYNYG  G
Sbjct:  176 FPCAPGQQYYGRGPIQISWNYNYGQCG 202          
BLAST of FC876330 vs. ExPASy Swiss-Prot
Match: CHI5_PHAVU (Endochitinase CH5B OS=Phaseolus vulgaris PE=3 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 4.660e-18
Identity = 34/89 (38.20%), Postives = 45/89 (50.56%), Query Frame = 2
Query:  266 FENFFSKRNTPVAHAVGFWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMSPSQSYC 532
            F+     RN     A GF+ Y +FI A   Y    FG TG    + +EI AFL     +T+ G+  A  GP AWG C+  E +PS +YC
Sbjct:   84 FDQVLKHRNDGACPAKGFYTYDAFIAAAKAYP--SFGNTGDTATRKREIAAFLGQTSHETTGGWATAPDGPYAWGYCFVRERNPS-AYC 169          

HSP 2 Score: 46.595 bits (109), Expect = 4.660e-18
Identity = 17/27 (62.96%), Postives = 19/27 (70.37%), Query Frame = 1
Query:  553 YPCTPGAEYYARGAIPIYWNYNYGATG 633
            +PC PG +YY RG I I WNYNYG  G
Sbjct:  175 FPCAPGQQYYGRGPIQISWNYNYGQCG 201          
BLAST of FC876330 vs. ExPASy Swiss-Prot
Match: CHI2_HORVU (26 kDa endochitinase 2 OS=Hordeum vulgare PE=1 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 7.922e-18
Identity = 35/102 (34.31%), Postives = 50/102 (49.02%), Query Frame = 2
Query:  236 TISDYFQVYQFENFFSKRNTPVAHAVGFWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMSPSQSYCDDS 541
            ++S      QF+     RN     A GF+ Y +F+ A   +   GFGTTG+   + +E+ AFLA    +T+ G+  A  G  AWG C+  E   S  YC  S
Sbjct:   24 SVSSIVSRAQFDRMLLHRNDGACQAKGFYTYDAFVAAAAAFP--GFGTTGSADAQKREVAAFLAQTSHETTGGWATAPDGAFAWGYCFKQERGASSDYCTPS 123          

HSP 2 Score: 40.0466 bits (92), Expect = 7.922e-18
Identity = 15/27 (55.56%), Postives = 17/27 (62.96%), Query Frame = 1
Query:  553 YPCTPGAEYYARGAIPIYWNYNYGATG 633
            +PC PG  YY RG I +  NYNYG  G
Sbjct:  126 WPCAPGKRYYGRGPIQLSHNYNYGPAG 152          
The following BLAST results are available for this feature:
BLAST of FC876330 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 35
Match NameE-valueIdentityDescription
CHID_SOLLC1.449e-2039.42Basic endochitinase (Fragment) OS=Solanum lycopers... [more]
CHIB_ARATH1.870e-2037.63Basic endochitinase B OS=Arabidopsis thaliana GN=C... [more]
CHI2_BRANA1.533e-1938.71Endochitinase CH25 OS=Brassica napus PE=2 SV=1[more]
CHIT_CARPA2.009e-1936.96Endochitinase OS=Carica papaya PE=1 SV=1[more]
CHI1_GOSHI4.385e-1940.00Endochitinase 1 OS=Gossypium hirsutum PE=3 SV=1[more]
CHI2_GOSHI4.392e-1940.00Endochitinase 2 (Fragment) OS=Gossypium hirsutum P... [more]
CHI10_ORYSJ1.257e-1836.67Chitinase 10 OS=Oryza sativa subsp. japonica GN=Ch... [more]
CHIT_PHAVU3.583e-1838.20Endochitinase OS=Phaseolus vulgaris PE=1 SV=1[more]
CHI5_PHAVU4.660e-1838.20Endochitinase CH5B OS=Phaseolus vulgaris PE=3 SV=1[more]
CHI2_HORVU7.922e-1834.3126 kDa endochitinase 2 OS=Hordeum vulgare PE=1 SV=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32003E01EF DevOvary1 Citrus clementina cDNA clone C32003E01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876330 ID=FC876330|Name=FC876330|organism=Citrus clementina|type=EST|length=634bp
GATCTTCCCCCAAGTGAATCTCGCAACAACAGGTAGATCTGGTGAGAACG
AGAAAATAAAGATGAAGAATGGCAGTGTGGCAATGACACTGACAGTGGCA
CTAGTACTGGCACTGGCAGTGAGTTTGGCAAATGGAGATGAATCAGAGAA
GGTGATAGTGAAGAAGGTGAAGGGGAAAAAAGTTTGCATAAAAGGGTGGG
AGTGCCCAACATGGTCGAAATTCTGCTGTAACGAGACGATATCAGACTAT
TTCCAGGTTTACCAGTTTGAGAATTTCTTCTCGAAAAGGAACACGCCGGT
GGCACATGCCGTGGGCTTCTGGGATTATCAGTCTTTCATTACTGCCACCG
TCAAATATCAGCCCCTCGGCTTCGGTACCACCGGTACTAAGCTTGATAAG
ATGAAGGAGATTTGCGCTTTTCTTGCCCACGTCGGCTGCAAGACCTCTTG
TGGATATGGGGTGGCCACTGGAGGACCATTGGCCTGGGGACTTTGCTACA
ACCATGAAATGAGCCCCAGCCAGTCATATTGTGATGATTCCTACAATACA
CATATCCCTGCACCCCTGGAGCTGAGTACTACGCCCGAGGTGCTATACCT
ATATACTGGAACTATAACTATGGAGCTACTGGGG
back to top