FC920417

Overview
NameFC920417
Unique NameFC920417
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length680
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC920417_ssr32 microsatellite FC920417_ssr32:32..59. BLAST: Citrus ESTs to Prunus persica proteins V1
FC920417_ssr210 microsatellite FC920417_ssr210:210..219. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of FC920417 vs. ExPASy Swiss-Prot
Match: YHKF_SCHPO (Uncharacterized RNA-binding protein C660.15 OS=Schizosaccharomyces pombe GN=SPBC660.15 PE=2 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 5.885e-14
Identity = 32/79 (40.51%), Postives = 53/79 (67.09%), Query Frame = 3
Query:  417 KLVVLGIPWDVDTDGLREYMSKFGDLEDCVVMKERSTGRSRGFGYVTFASAEDAKTALSAEHFLGSRMLEVKIATPKEE 653
            K+ + G+ W+   D LR+Y  +FG++ DC VM++ +TGRSRGFG++TF + +     +S EH L  ++++ K A P+EE
Sbjct:  164 KMFIGGLNWETTDDSLRDYFEQFGEVLDCTVMRDSTTGRSRGFGFLTFKNPKCVNEVMSKEHHLDGKIIDPKRAIPREE 242          
BLAST of FC920417 vs. ExPASy Swiss-Prot
Match: MSI2H_MOUSE (RNA-binding protein Musashi homolog 2 OS=Mus musculus GN=Msi2 PE=1 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 6.507e-13
Identity = 36/89 (40.45%), Postives = 55/89 (61.80%), Query Frame = 3
Query:  417 KLVVLGIPWDVDTDGLREYMSKFGDLEDCVVMKERSTGRSRGFGYVTFASAEDAKTALSAEHF-LGSRMLEVKIATPKEEMRAPPRKVS 680
            K+ + G+ W    D LR+Y SKFG++ +C+VM++ +T RSRGFG+VTFA        L   H  L S+ ++ K+A P+   RA P+ V+
Sbjct:   22 KMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHELDSKTIDPKVAFPR---RAQPKMVT 107          
BLAST of FC920417 vs. ExPASy Swiss-Prot
Match: MSI2H_HUMAN (RNA-binding protein Musashi homolog 2 OS=Homo sapiens GN=MSI2 PE=1 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 6.507e-13
Identity = 36/89 (40.45%), Postives = 55/89 (61.80%), Query Frame = 3
Query:  417 KLVVLGIPWDVDTDGLREYMSKFGDLEDCVVMKERSTGRSRGFGYVTFASAEDAKTALSAEHF-LGSRMLEVKIATPKEEMRAPPRKVS 680
            K+ + G+ W    D LR+Y SKFG++ +C+VM++ +T RSRGFG+VTFA        L   H  L S+ ++ K+A P+   RA P+ V+
Sbjct:   22 KMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHELDSKTIDPKVAFPR---RAQPKMVT 107          
BLAST of FC920417 vs. ExPASy Swiss-Prot
Match: HRP1_YEAST (Nuclear polyadenylated RNA-binding protein 4 OS=Saccharomyces cerevisiae GN=HRP1 PE=1 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 5.508e-12
Identity = 29/79 (36.71%), Postives = 48/79 (60.76%), Query Frame = 3
Query:  417 KLVVLGIPWDVDTDGLREYMSKFGDLEDCVVMKERSTGRSRGFGYVTFASAEDAKTALSAEHFLGSRMLEVKIATPKEE 653
            K+ + G+ WD   D LREY  K+G + D  +MK+ +TGRSRGFG+++F         +  +H L  ++++ K A P++E
Sbjct:  160 KMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKTQHILDGKVIDPKRAIPRDE 238          
BLAST of FC920417 vs. ExPASy Swiss-Prot
Match: MSI1H_RAT (RNA-binding protein Musashi homolog 1 OS=Rattus norvegicus GN=Msi1 PE=2 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.227e-11
Identity = 35/89 (39.33%), Postives = 56/89 (62.92%), Query Frame = 3
Query:  417 KLVVLGIPWDVDTDGLREYMSKFGDLEDCVVMKERSTGRSRGFGYVTFA-SAEDAKTALSAEHFLGSRMLEVKIATPKEEMRAPPRKVS 680
            K+ + G+ W    +GLREY  +FG++++C+VM++  T RSRGFG+VTF   A   K    + H L S+ ++ K+A P+   RA P+ V+
Sbjct:   21 KMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPR---RAQPKMVT 106          
BLAST of FC920417 vs. ExPASy Swiss-Prot
Match: MSI1H_MOUSE (RNA-binding protein Musashi homolog 1 OS=Mus musculus GN=Msi1 PE=1 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.227e-11
Identity = 35/89 (39.33%), Postives = 56/89 (62.92%), Query Frame = 3
Query:  417 KLVVLGIPWDVDTDGLREYMSKFGDLEDCVVMKERSTGRSRGFGYVTFA-SAEDAKTALSAEHFLGSRMLEVKIATPKEEMRAPPRKVS 680
            K+ + G+ W    +GLREY  +FG++++C+VM++  T RSRGFG+VTF   A   K    + H L S+ ++ K+A P+   RA P+ V+
Sbjct:   21 KMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPR---RAQPKMVT 106          
BLAST of FC920417 vs. ExPASy Swiss-Prot
Match: MSI1H_HUMAN (RNA-binding protein Musashi homolog 1 OS=Homo sapiens GN=MSI1 PE=1 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.227e-11
Identity = 35/89 (39.33%), Postives = 56/89 (62.92%), Query Frame = 3
Query:  417 KLVVLGIPWDVDTDGLREYMSKFGDLEDCVVMKERSTGRSRGFGYVTFA-SAEDAKTALSAEHFLGSRMLEVKIATPKEEMRAPPRKVS 680
            K+ + G+ W    +GLREY  +FG++++C+VM++  T RSRGFG+VTF   A   K    + H L S+ ++ K+A P+   RA P+ V+
Sbjct:   21 KMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPR---RAQPKMVT 106          
BLAST of FC920417 vs. ExPASy Swiss-Prot
Match: ROA3_RAT (Heterogeneous nuclear ribonucleoprotein A3 OS=Rattus norvegicus GN=Hnrnpa3 PE=1 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 2.734e-11
Identity = 34/85 (40.00%), Postives = 53/85 (62.35%), Query Frame = 3
Query:  414 KKLVVLGIPWDVDTDGLREYMSKFGDLEDCVVMKERSTGRSRGFGYVTFASAEDAKTALSAE-HFLGSRMLEVKIATPKEEMRAP 665
            +KL + G+ ++   D LRE+  K+G L DCVVM++  T RSRGFG+VT++  E+   A+ A  H +  R++E K A  +E+   P
Sbjct:   35 RKLFIGGLSFETTDDSLREHFEKWGTLTDCVVMRDPQTKRSRGFGFVTYSCVEEVDAAMCARPHKVDGRVVEPKRAVSREDSVKP 119          
BLAST of FC920417 vs. ExPASy Swiss-Prot
Match: ROA3_MOUSE (Heterogeneous nuclear ribonucleoprotein A3 OS=Mus musculus GN=Hnrnpa3 PE=1 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 2.734e-11
Identity = 34/85 (40.00%), Postives = 53/85 (62.35%), Query Frame = 3
Query:  414 KKLVVLGIPWDVDTDGLREYMSKFGDLEDCVVMKERSTGRSRGFGYVTFASAEDAKTALSAE-HFLGSRMLEVKIATPKEEMRAP 665
            +KL + G+ ++   D LRE+  K+G L DCVVM++  T RSRGFG+VT++  E+   A+ A  H +  R++E K A  +E+   P
Sbjct:   35 RKLFIGGLSFETTDDSLREHFEKWGTLTDCVVMRDPQTKRSRGFGFVTYSCVEEVDAAMCARPHKVDGRVVEPKRAVSREDSVKP 119          
BLAST of FC920417 vs. ExPASy Swiss-Prot
Match: ROA3_HUMAN (Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens GN=HNRNPA3 PE=1 SV=2)

HSP 1 Score: 68.9366 bits (167), Expect = 2.734e-11
Identity = 34/85 (40.00%), Postives = 53/85 (62.35%), Query Frame = 3
Query:  414 KKLVVLGIPWDVDTDGLREYMSKFGDLEDCVVMKERSTGRSRGFGYVTFASAEDAKTALSAE-HFLGSRMLEVKIATPKEEMRAP 665
            +KL + G+ ++   D LRE+  K+G L DCVVM++  T RSRGFG+VT++  E+   A+ A  H +  R++E K A  +E+   P
Sbjct:   35 RKLFIGGLSFETTDDSLREHFEKWGTLTDCVVMRDPQTKRSRGFGFVTYSCVEEVDAAMCARPHKVDGRVVEPKRAVSREDSVKP 119          
The following BLAST results are available for this feature:
BLAST of FC920417 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 26
Match NameE-valueIdentityDescription
YHKF_SCHPO5.885e-1440.51Uncharacterized RNA-binding protein C660.15 OS=Sch... [more]
MSI2H_MOUSE6.507e-1340.45RNA-binding protein Musashi homolog 2 OS=Mus muscu... [more]
MSI2H_HUMAN6.507e-1340.45RNA-binding protein Musashi homolog 2 OS=Homo sapi... [more]
HRP1_YEAST5.508e-1236.71Nuclear polyadenylated RNA-binding protein 4 OS=Sa... [more]
MSI1H_RAT1.227e-1139.33RNA-binding protein Musashi homolog 1 OS=Rattus no... [more]
MSI1H_MOUSE1.227e-1139.33RNA-binding protein Musashi homolog 1 OS=Mus muscu... [more]
MSI1H_HUMAN1.227e-1139.33RNA-binding protein Musashi homolog 1 OS=Homo sapi... [more]
ROA3_RAT2.734e-1140.00Heterogeneous nuclear ribonucleoprotein A3 OS=Ratt... [more]
ROA3_MOUSE2.734e-1140.00Heterogeneous nuclear ribonucleoprotein A3 OS=Mus ... [more]
ROA3_HUMAN2.734e-1140.00Heterogeneous nuclear ribonucleoprotein A3 OS=Homo... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32008B04EF RVDevelop1 Citrus clementina cDNA clone C32008B04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920417 ID=FC920417|Name=FC920417|organism=Citrus clementina|type=EST|length=680bp
GATTGCTAGATAGAGGTAGGAAGAGGATTTTAGAGAGAGAGAGAGAGAGA
GAGAGAGAGGTCGATGCATTAGGGTTTTGAAAATCGGACCACAGATTCGA
TAAAGGTCAGTGAGCGCGCAATCTCCATTCAATTGATTGATTTTAATTTT
AATTTTAGAGGACAATTAAAAAAAAAATGGTGAGTTTGATGATTTGGCAT
TTGATGAATTGTGTGTGTGAGAAAGAGGTGTACTTTACATGTGCAGGAGG
AGGAATCGAGTGTGTTACTGGGAAGAAGAGAGATAGAGAGAAAATTGTAG
TGATTTGAGTGCTCGAGAACTGAGTTGTTTGAGCGTTAGGGGTTTTCCCC
TTTTCCTCATCTCTCCCTCTGTAGCCGCTTCTTTCATTTTTCCAGCTTTC
AATTCTCATGGAGAAAAAGCTTGTGGTTCTGGGTATTCCATGGGATGTCG
ATACAGATGGTTTAAGAGAGTACATGAGCAAATTTGGGGATTTGGAGGAC
TGCGTTGTCATGAAGGAGCGGTCCACAGGGCGATCGCGTGGATTTGGCTA
TGTTACATTTGCATCTGCTGAAGATGCTAAGACAGCTTTGTCAGCTGAGC
ACTTTCTTGGCAGCAGAATGCTAGAAGTTAAAATAGCTACCCCTAAGGAG
GAGATGAGAGCACCCCCAAGGAAAGTGTCC
back to top