FC920420

Overview
NameFC920420
Unique NameFC920420
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length598
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14651 contig Ccv1_Contig14651:7..602. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920420 vs. ExPASy Swiss-Prot
Match: IFRH_SOLTU (Isoflavone reductase homolog OS=Solanum tuberosum PE=2 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 2.180e-52
Identity = 70/103 (67.96%), Postives = 80/103 (77.67%), Query Frame = 3
Query:   81 KERFYSSAGQGISVKFTVEASVKAGHPTFVLVRESTISGPSKSQLLDHFKNLGVNLVIGDVLNHESLVKAIKQVDVGISTDGHTLLADQVKIIAAIKEAGNVK 389
            K +     G G   KF VEAS KAGH TFVLVREST+S P+K++L+D FK+ GV  V GD+ +HESLVKAIKQVDV IST GH LLADQVK+IAAIKEAGNVK
Sbjct:    4 KSKILFIGGTGYIGKFIVEASAKAGHDTFVLVRESTLSNPTKTKLIDTFKSFGVTFVHGDLYDHESLVKAIKQVDVVISTVGHALLADQVKLIAAIKEAGNVK 106          

HSP 2 Score: 94.3597 bits (233), Expect = 2.180e-52
Identity = 46/71 (64.79%), Postives = 54/71 (76.06%), Query Frame = 1
Query:  385 LKRFLPSEFGNDVDRVEGAV*PTKSTYDVKAKIRRAVEAEGIPYTYVESYCFDGYFLPNLLQPEATAPPRD 597
            +KRF PSEFGNDVDRV  AV P K+ ++ KA+IRR VEAEGIP+TYV ++ F GY LPNL QP A  PP D
Sbjct:  105 VKRFFPSEFGNDVDRVH-AVEPAKAAFNTKAQIRRVVEAEGIPFTYVATFFFAGYSLPNLAQPGAAGPPND 174          
BLAST of FC920420 vs. ExPASy Swiss-Prot
Match: IFRH_ARATH (Isoflavone reductase homolog P3 OS=Arabidopsis thaliana GN=At1g75280 PE=1 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 6.580e-45
Identity = 62/106 (58.49%), Postives = 74/106 (69.81%), Query Frame = 3
Query:   81 KERFYSSAGQGISVKFTVEASVKAGHPTFVLVRESTISGPSKSQLLDHFKNLGVNLVIGDVLNHESLVKAIKQVDVGISTDGHTLLADQVKIIAAIKEAGNVKEIL 398
            K +     G G   KF VEAS KAGH TF LVRE+T+S P K + +  FK+LGV ++ GD+ +HESLVKAIKQVDV IST G   + DQ KII+AIKEAGNVK  L
Sbjct:    5 KSKILVIGGTGYIGKFLVEASAKAGHSTFALVREATLSDPVKGKTVQSFKDLGVTILHGDLNDHESLVKAIKQVDVVISTVGSMQILDQTKIISAIKEAGNVKRFL 110          

HSP 2 Score: 87.0409 bits (214), Expect = 6.580e-45
Identity = 45/73 (61.64%), Postives = 53/73 (72.60%), Query Frame = 1
Query:  385 LKRFLPSEFGNDVDRVEGAV*PTKSTYDVKAKIRRAVEAEGIPYTYVESYCFDGYFLPNLLQ--PEATAPPRD 597
            +KRFLPSEFG DVDR   AV P KS +  K +IRR +EAEGIPYTY  + CF GY+LP L+Q  P  T+PPRD
Sbjct:  106 VKRFLPSEFGVDVDRTS-AVEPAKSAFAGKIQIRRTIEAEGIPYTYAVTGCFGGYYLPTLVQFEPGLTSPPRD 177          
BLAST of FC920420 vs. ExPASy Swiss-Prot
Match: IFRH_TOBAC (Isoflavone reductase homolog A622 OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 1.211e-43
Identity = 60/106 (56.60%), Postives = 72/106 (67.92%), Query Frame = 3
Query:   81 KERFYSSAGQGISVKFTVEASVKAGHPTFVLVRESTISGPSKSQLLDHFKNLGVNLVIGDVLNHESLVKAIKQVDVGISTDGHTLLADQVKIIAAIKEAGNVKEIL 398
            K +     G G   K+ VE S K+GHPTF L+REST+  P KS+L+D FK+ GV L+ GD+ N ESL+KAIKQVDV IST G     DQV II AIKEAGN+K  L
Sbjct:    6 KSKILIIGGTGYIGKYLVETSAKSGHPTFALIRESTLKNPEKSKLIDTFKSYGVTLLFGDISNQESLLKAIKQVDVVISTVGGQQFTDQVNIIKAIKEAGNIKRFL 111          

HSP 2 Score: 80.8777 bits (198), Expect = 1.211e-43
Identity = 42/71 (59.15%), Postives = 49/71 (69.01%), Query Frame = 1
Query:  385 LKRFLPSEFGNDVDRVEGAV*PTKSTYDVKAKIRRAVEAEGIPYTYVESYCFDGYFLPNLLQPEATAPPRD 597
            +KRFLPSEFG DVD    A+ P  S + +K +IRR +EAEGIPYTYV    F  +FLPNL Q EA  PPRD
Sbjct:  107 IKRFLPSEFGFDVDHAR-AIEPAASLFALKVRIRRMIEAEGIPYTYVICNWFADFFLPNLGQLEAKTPPRD 176          
BLAST of FC920420 vs. ExPASy Swiss-Prot
Match: IFR_MEDSA (Isoflavone reductase OS=Medicago sativa GN=IFR PE=1 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 5.603e-37
Identity = 51/98 (52.04%), Postives = 71/98 (72.45%), Query Frame = 3
Query:  132 VEASVKAGHPTFVLVRES----------TISGP-SKSQLLDHFKNLGVNLVIGDVLNHESLVKAIKQVDVGISTDGHTLLADQVKIIAAIKEAGNVKE 392
            V AS+KAG+PT+ LVR++          T + P +K +L+D++++LGV L+ GD+ +HE+LVKAIKQVD+ I   G  L+ DQVKII AIKEAGNVK+
Sbjct:   21 VWASIKAGNPTYALVRKTPGNVNKPKLITAANPETKEELIDNYQSLGVILLEGDINDHETLVKAIKQVDIVICAAGRLLIEDQVKIIKAIKEAGNVKK 118          

HSP 2 Score: 83.9593 bits (206), Expect = 5.603e-37
Identity = 41/71 (57.75%), Postives = 51/71 (71.83%), Query Frame = 1
Query:  385 LKRFLPSEFGNDVDRVEGAV*PTKSTYDVKAKIRRAVEAEGIPYTYVESYCFDGYFLPNLLQPEATAPPRD 597
            +K+F PSEFG DVDR E AV P +  ++ KA IRR +EAEG+PYTY+  + F GYFL NL Q + T PPRD
Sbjct:  116 VKKFFPSEFGLDVDRHE-AVEPVRQVFEEKASIRRVIEAEGVPYTYLCCHAFTGYFLRNLAQLDTTDPPRD 185          
BLAST of FC920420 vs. ExPASy Swiss-Prot
Match: IFR_CICAR (Isoflavone reductase OS=Cicer arietinum GN=IFR PE=1 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 7.298e-37
Identity = 53/100 (53.00%), Postives = 67/100 (67.00%), Query Frame = 3
Query:  123 KFTVEASVKAGHPTFVLVREST--ISGPS---------KSQLLDHFKNLGVNLVIGDVLNHESLVKAIKQVDVGISTDGHTLLADQVKIIAAIKEAGNVK 389
            +  V AS+KAG+PT+ L+R++   I+ PS         K +LL  FK  GV L+ GD+ +HE+LVKAIKQVD  I T G  L+ DQVKII AIKEAGNVK
Sbjct:   18 RHVVWASIKAGNPTYALIRKTPGDINKPSLVAAANPESKEELLQSFKAAGVILLEGDMNDHEALVKAIKQVDTVICTFGRLLILDQVKIIKAIKEAGNVK 117          

HSP 2 Score: 87.0409 bits (214), Expect = 7.298e-37
Identity = 44/71 (61.97%), Postives = 52/71 (73.24%), Query Frame = 1
Query:  385 LKRFLPSEFGNDVDRVEGAV*PTKSTYDVKAKIRRAVEAEGIPYTYVESYCFDGYFLPNLLQPEATAPPRD 597
            +KRF PSEFG DVDR + AV P +  +D KA IRR VEAEG+PYTY+  + F GYFL NL Q +AT PPRD
Sbjct:  116 VKRFFPSEFGLDVDRHD-AVDPVRPVFDEKASIRRVVEAEGVPYTYLCCHAFTGYFLRNLAQFDATEPPRD 185          
BLAST of FC920420 vs. ExPASy Swiss-Prot
Match: IFR_PEA (Isoflavone reductase OS=Pisum sativum GN=IFR PE=2 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 3.190e-34
Identity = 42/71 (59.15%), Postives = 52/71 (73.24%), Query Frame = 1
Query:  385 LKRFLPSEFGNDVDRVEGAV*PTKSTYDVKAKIRRAVEAEGIPYTYVESYCFDGYFLPNLLQPEATAPPRD 597
            +KRF PSEFG DVDR + AV P +  ++ KA IRR VE+EG+PYTY+  + F GYFL NL Q +AT PPRD
Sbjct:  116 VKRFFPSEFGLDVDRHD-AVEPVRQVFEEKASIRRVVESEGVPYTYLCCHAFTGYFLRNLAQIDATDPPRD 185          

HSP 2 Score: 81.6481 bits (200), Expect = 3.190e-34
Identity = 47/97 (48.45%), Postives = 66/97 (68.04%), Query Frame = 3
Query:  132 VEASVKAGHPTFVLVREST--ISGP---------SKSQLLDHFKNLGVNLVIGDVLNHESLVKAIKQVDVGISTDGHTLLADQVKIIAAIKEAGNVK 389
            V AS+KAG+PT+ LVR+++  ++ P         +K +LL +++  GV L+ GD+ +HE+LV AIKQVD  I   G  L+ DQVK+I AIKEAGNVK
Sbjct:   21 VWASIKAGNPTYALVRKTSDNVNKPKLTEAANPETKEELLKNYQASGVILLEGDINDHETLVNAIKQVDTVICAAGRLLIEDQVKVIKAIKEAGNVK 117          
BLAST of FC920420 vs. ExPASy Swiss-Prot
Match: IFRH_MAIZE (Isoflavone reductase homolog IRL OS=Zea mays GN=IRL PE=2 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 1.496e-30
Identity = 46/103 (44.66%), Postives = 63/103 (61.17%), Query Frame = 3
Query:   81 KERFYSSAGQGISVKFTVEASVKAGHPTFVLVRESTISGPSKSQLLDHFKNLGVNLVIGDVLNHESLVKAIKQVDVGISTDGHTLLADQVKIIAAIKEAGNVK 389
            K +     G G   +  V AS + GHPT  LVR++  S P+K+ LL  F++ GV L+ GD+ +  SLV A+K  DV IS  G   +ADQ +++ AIKEAGNVK
Sbjct:    5 KSKILVVGGTGYLGRHVVAASARLGHPTSALVRDTAPSDPAKAALLKSFQDAGVTLLKGDLYDQASLVSAVKGADVVISVLGSMQIADQSRLVDAIKEAGNVK 107          

HSP 2 Score: 69.3218 bits (168), Expect = 1.496e-30
Identity = 39/71 (54.93%), Postives = 43/71 (60.56%), Query Frame = 1
Query:  385 LKRFLPSEFGNDVDRVEGAV*PTKSTYDVKAKIRRAVEAEGIPYTYVESYCFDGYFLPNLLQPEATAPPRD 597
            +KRF PSEFG DVDR  G V P KS    K  IRRA EA GIPYTY  +  F G+ LP + Q  A  PP D
Sbjct:  106 VKRFFPSEFGLDVDRT-GIVEPAKSILGAKVGIRRATEAAGIPYTYAVAGFFAGFGLPKVGQVLAPGPPAD 175          
BLAST of FC920420 vs. ExPASy Swiss-Prot
Match: IGS1_PETHY (Isoeugenol synthase 1 OS=Petunia hybrida GN=IGS1 PE=1 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 3.403e-27
Identity = 40/93 (43.01%), Postives = 57/93 (61.29%), Query Frame = 3
Query:  123 KFTVEASVKAGHPTFVLVRE-STISGPSKSQLLDHFKNLGVNLVIGDVLNHESLVKAIKQVDVGISTDGHTLLADQVKIIAAIKEAGNVKEIL 398
            K+ V+AS+  GHPT+  V      S  SK QLL  F++LGV +  G++  H+ LV   K+VD+ IST       +Q+K+I AIKEAGN+K  +
Sbjct:   19 KYMVKASISLGHPTYAYVMPLKKNSDDSKLQLLKEFESLGVTIFYGELSEHDKLVAVFKEVDIVISTLAVPQYLEQLKVIEAIKEAGNIKRFV 111          

HSP 2 Score: 63.5438 bits (153), Expect = 3.403e-27
Identity = 33/63 (52.38%), Postives = 43/63 (68.25%), Query Frame = 1
Query:  385 LKRFLPSEFGNDVDRVEGAV*PTKSTYDVKAKIRRAVEAEGIPYTYVESYCFDGYFLPNLLQP 573
            +KRF+PSEFGN+VDRV  A+   ++  D K KIRRA EA GIP+T+V +     YF+  LL P
Sbjct:  107 IKRFVPSEFGNEVDRVR-ALPRFQAVLDNKKKIRRATEAAGIPFTFVSANSLTAYFVDYLLHP 168          

HSP 3 Score: 24.2534 bits (51), Expect = 3.403e-27
Identity = 9/15 (60.00%), Postives = 12/15 (80.00%), Query Frame = 2
Query:   80 KRKILFIGGTGYIGE 124
            K KIL +G TGY+G+
Sbjct:    5 KGKILILGATGYLGK 19          
BLAST of FC920420 vs. ExPASy Swiss-Prot
Match: EGS1_OCIBA (Eugenol synthase 1 OS=Ocimum basilicum GN=EGS1 PE=1 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 2.596e-26
Identity = 44/106 (41.51%), Postives = 62/106 (58.49%), Query Frame = 3
Query:   81 KERFYSSAGQGISVKFTVEASVKAGHPTFVLVRESTISGPSKSQLLDHFKNLGVNLVIGDVLNHESLVKAIKQVDVGISTDGHTLLADQVKIIAAIKEAGNVKEIL 398
            K +     G G      V+ S+K GHPT+V  R ++    SK+ LLD F++LG  +V G++  HE LV+ +K+VDV IS      + DQ KI+ AIK AGN+K  L
Sbjct:    7 KSKILIFGGTGYIGNHMVKGSLKLGHPTYVFTRPNS----SKTTLLDEFQSLGAIIVKGELDEHEKLVELMKKVDVVISALAFPQILDQFKILEAIKVAGNIKRFL 108          

HSP 2 Score: 62.7734 bits (151), Expect = 2.596e-26
Identity = 31/63 (49.21%), Postives = 43/63 (68.25%), Query Frame = 1
Query:  385 LKRFLPSEFGNDVDRVEGAV*PTKSTYDVKAKIRRAVEAEGIPYTYVESYCFDGYFLPNLLQP 573
            +KRFLPS+FG + DR+  A+ P ++  + K  IRRA+E   IPYTYV + CF  YF+  LL+P
Sbjct:  104 IKRFLPSDFGVEEDRIN-ALPPFEALIERKRMIRRAIEEANIPYTYVSANCFASYFINYLLRP 165          
BLAST of FC920420 vs. ExPASy Swiss-Prot
Match: IFRH_LUPAL (Isoflavone reductase homolog OS=Lupinus albus PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 9.700e-26
Identity = 34/71 (47.89%), Postives = 46/71 (64.79%), Query Frame = 1
Query:  385 LKRFLPSEFGNDVDRVEGAV*PTKSTYDVKAKIRRAVEAEGIPYTYVESYCFDGYFLPNLLQPEATAPPRD 597
            +KRFLPSEFG D   +  A+ P + T+D K  +R+A+E   IP+TY+ + CF GYF  NL Q +   PPRD
Sbjct:  109 IKRFLPSEFGMDPALMGHALEPGRVTFDEKMTVRKAIEEANIPFTYISANCFAGYFAGNLSQMKTLLPPRD 179          

HSP 2 Score: 64.6994 bits (156), Expect = 9.700e-26
Identity = 43/112 (38.39%), Postives = 59/112 (52.68%), Query Frame = 3
Query:   81 KERFYSSAGQGISVKFTVEASVKAGHPTFVLVRESTISGPSKSQLLDHFKNLGVNLVIGDVLNHESLVKAIKQVDV------GISTDGHTLLADQVKIIAAIKEAGNVKEIL 398
            K +     G G   +  V+AS++ GH TF+L R        K Q+L  FK  G  LV     +H+SLV A+K VDV      G+    H LL  Q+K++ AIK+AGN+K  L
Sbjct:    3 KSKVLVVGGTGYVGRRIVKASLEHGHETFILQRPEIGLDIEKLQILLSFKKQGAILVEASFSDHKSLVDAVKLVDVVICTMSGVHFRSHNLLT-QLKLVEAIKDAGNIKRFL 113          
The following BLAST results are available for this feature:
BLAST of FC920420 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 11
Match NameE-valueIdentityDescription
IFRH_SOLTU2.180e-5267.96Isoflavone reductase homolog OS=Solanum tuberosum ... [more]
IFRH_ARATH6.580e-4558.49Isoflavone reductase homolog P3 OS=Arabidopsis tha... [more]
IFRH_TOBAC1.211e-4356.60Isoflavone reductase homolog A622 OS=Nicotiana tab... [more]
IFR_MEDSA5.603e-3752.04Isoflavone reductase OS=Medicago sativa GN=IFR PE=... [more]
IFR_CICAR7.298e-3753.00Isoflavone reductase OS=Cicer arietinum GN=IFR PE=... [more]
IFR_PEA3.190e-3459.15Isoflavone reductase OS=Pisum sativum GN=IFR PE=2 ... [more]
IFRH_MAIZE1.496e-3044.66Isoflavone reductase homolog IRL OS=Zea mays GN=IR... [more]
IGS1_PETHY3.403e-2743.01Isoeugenol synthase 1 OS=Petunia hybrida GN=IGS1 P... [more]
EGS1_OCIBA2.596e-2641.51Eugenol synthase 1 OS=Ocimum basilicum GN=EGS1 PE=... [more]
IFRH_LUPAL9.700e-2647.89Isoflavone reductase homolog OS=Lupinus albus PE=2... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32008B07EF RVDevelop1 Citrus clementina cDNA clone C32008B07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920420 ID=FC920420|Name=FC920420|organism=Citrus clementina|type=EST|length=598bp
GATCCATTTGATCATTTCAAAACAAAACGAAAAAAAAAATCTCAGTAATT
GAACTGAACGAGTCTCAGAAATGGCATCGAAAAGAAAGATTCTATTCATC
GGCGGGACAGGGTATATCGGTGAAATTCACTGTCGAAGCGAGCGTAAAAG
CCGGCCACCCGACGTTCGTGCTCGTGAGAGAATCCACAATCTCTGGTCCT
TCCAAATCTCAACTCCTCGATCACTTCAAAAACCTCGGCGTCAATCTCGT
CATAGGAGATGTGTTGAATCACGAGAGTTTGGTGAAGGCGATTAAACAAG
TGGACGTGGGGATATCAACGGACGGTCACACTTTATTAGCTGATCAGGTC
AAGATTATTGCTGCCATTAAAGAAGCCGGTAACGTTAAAGAGATTCTTAC
CATCGGAATTTGGAAATGATGTTGATCGAGTCGAAGGCGCCGTATAGCCA
ACAAAATCGACGTATGACGTAAAGGCGAAAATCCGCCGAGCCGTTGAGGC
AGAAGGCATTCCGTACACTTACGTAGAATCTTATTGTTTTGATGGCTATT
TCCTCCCCAATTTGTTGCAGCCTGAGGCCACTGCCCCCCCTAGGGATA
back to top