FC920475

Overview
NameFC920475
Unique NameFC920475
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length702
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9398 contig Ccv1_Contig9398:191..892. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920475 vs. ExPASy Swiss-Prot
Match: BPS1_ARATH (Protein BPS1, chloroplastic OS=Arabidopsis thaliana GN=BPS1 PE=2 SV=1)

HSP 1 Score: 278.87 bits (712), Expect = 1.862e-74
Identity = 133/198 (67.17%), Postives = 165/198 (83.33%), Query Frame = 1
Query:   97 MSRPQDPHRPFFPFGNPFRMMSPKGSRLSPKLVSLLADFEETLAERLRKLMPKDKDDILNLSWMRLAMESLCETHNVIKDLITELELPVSDWDEKWIDVYLDISVNLLDICIAFSSVLTKVSQGHLLLQCVLHTLDSSSPTQFGRACSSLDNWREHISSKNPRVESCRSILDNLVASLDLPKVKNSAKGKVLMRAMYG 690
            M+RPQDP R FFPFGNPF+ +S K S LS KL+ LL +FE  LA  + KL+PK+K DIL +SWM+ AMESLCETHN IK LIT+LELPVSDW++KW+DVYLDISV LLD+C AFSS LT+++QGHLLLQ  LH L+++SP    +A SSLD+W++HI SKNPR+E+CR+IL +LV +L+LPKVKNSAKGKVLMRA+YG
Sbjct:    1 MARPQDPPRGFFPFGNPFKNLSSKNSVLSSKLLPLLNNFETNLASSISKLVPKEKSDILTVSWMKQAMESLCETHNGIKTLITDLELPVSDWEDKWVDVYLDISVKLLDLCNAFSSELTRLNQGHLLLQFALHNLEANSPQNLSKAQSSLDSWKQHIVSKNPRIENCRAILSSLVQTLNLPKVKNSAKGKVLMRALYG 198          
BLAST of FC920475 vs. ExPASy Swiss-Prot
Match: U496D_ORYSI (UPF0496 protein 4 OS=Oryza sativa subsp. indica GN=OsI_033149 PE=3 SV=2)

HSP 1 Score: 213.001 bits (541), Expect = 1.255e-54
Identity = 113/202 (55.94%), Postives = 136/202 (67.33%), Query Frame = 1
Query:   97 MSRPQDPHRPFFPFGNPFRMMSPKGSRLSPKLVSLLADFEETLAERLRKLMPKDKDDILNLSWMRLAMESLCETHNVIKDLITELELPVSDWDEKWIDVYLDISVNLLDICIAFSSVLTKVSQGHLLLQCVLHTLDSS----SPTQFGRACSSLDNWREHISSKNPRVESCRSILDNLVASLDLPKVKNSAKGKVLMRAMYG 690
            MSR     R FFP GNPFR+M P G+ LS KL  LLA +E+ LA  LRKL P+   D+L LSWMRLA++ L E H  I +LIT+LELPVSDWD+KW+D+YL+ SV LLDICIA SS L+++ QG LLLQ  LH L S     S  Q  RA  SL  W E +  + PR+ SC + L  L  +L L KVKNS KGKVLMRA+YG
Sbjct:    1 MSRAHGSPRSFFPVGNPFRVMFPGGAHLSRKLQELLASYEDALALSLRKLKPEAASDVLTLSWMRLAVDCLSELHTNIANLITDLELPVSDWDDKWVDIYLNSSVKLLDICIALSSELSRLDQGQLLLQYALHVLGSESGVPSQEQLKRAEPSLREWMELVGVRCPRLVSCSATLQELAGNLSLMKVKNSVKGKVLMRALYG 202          
BLAST of FC920475 vs. ExPASy Swiss-Prot
Match: U496D_ORYSJ (UPF0496 protein 4 OS=Oryza sativa subsp. japonica GN=Os10g0513300 PE=2 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 3.652e-54
Identity = 113/202 (55.94%), Postives = 136/202 (67.33%), Query Frame = 1
Query:   97 MSRPQDPHRPFFPFGNPFRMMSPKGSRLSPKLVSLLADFEETLAERLRKLMPKDKDDILNLSWMRLAMESLCETHNVIKDLITELELPVSDWDEKWIDVYLDISVNLLDICIAFSSVLTKVSQGHLLLQCVLHTLDSS----SPTQFGRACSSLDNWREHISSKNPRVESCRSILDNLVASLDLPKVKNSAKGKVLMRAMYG 690
            MSR     R FFP GNPFR+M P G+ LS KL  LLA +E+ LA  LRKL P+   D+L LSWMRLA++ L E H  I +LIT+LELPVSDWD+KW+D+YL+ SV LLDICIA SS L+++ QG LLLQ  LH L S     S  Q  RA  SL  W E +  +  R+ SC + L  L  +L L KVKNSAKGKVLMRA+YG
Sbjct:    1 MSRAHGSPRSFFPVGNPFRVMFPGGAHLSRKLQELLASYEDALALSLRKLKPEAASDVLTLSWMRLAVDCLSELHTNIANLITDLELPVSDWDDKWVDIYLNSSVKLLDICIALSSELSRLDQGQLLLQYALHVLGSESGVPSQEQLKRAEPSLREWMELVGVRCARLVSCSATLQELAGNLSLMKVKNSAKGKVLMRALYG 202          
The following BLAST results are available for this feature:
BLAST of FC920475 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
BPS1_ARATH1.862e-7467.17Protein BPS1, chloroplastic OS=Arabidopsis thalian... [more]
U496D_ORYSI1.255e-5455.94UPF0496 protein 4 OS=Oryza sativa subsp. indica GN... [more]
U496D_ORYSJ3.652e-5455.94UPF0496 protein 4 OS=Oryza sativa subsp. japonica ... [more]
back to top
Properties
Property NameValue
Genbank descriptionC32008H03EF RVDevelop1 Citrus clementina cDNA clone C32008H03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920475 ID=FC920475|Name=FC920475|organism=Citrus clementina|type=EST|length=702bp
AGTTACGGTCTGCCATTAATTCTTTGTTAAGTATTTCGATTTAACCGAAT
AATCAGTTTTTCGATCCACGATCTATTGTTAAGCAAATCCATCAAAATGA
GTCGCCCCCAGGATCCACACCGTCCTTTCTTCCCATTTGGAAATCCTTTT
CGGATGATGTCCCCCAAAGGTTCTCGTTTGTCTCCCAAGCTTGTATCTCT
GTTGGCTGATTTTGAGGAGACCTTGGCAGAGAGGCTGAGAAAACTTATGC
CGAAAGACAAGGATGATATCCTCAACTTATCATGGATGAGACTGGCAATG
GAGTCACTTTGTGAGACTCACAATGTCATAAAAGACCTTATAACTGAGTT
GGAGCTTCCTGTAAGTGACTGGGATGAGAAATGGATAGACGTGTACTTAG
ACATCAGTGTAAACTTGCTTGATATATGCATTGCTTTTAGCTCTGTTCTC
ACGAAGGTCAGCCAAGGCCACCTATTGCTTCAGTGTGTCTTGCACACTTT
GGATTCTTCCTCTCCAACACAGTTTGGGCGAGCCTGTTCTTCTCTTGATA
ACTGGAGGGAGCACATTAGTTCAAAGAACCCCAGAGTTGAGAGCTGTCGT
TCAATCTTAGACAATCTGGTAGCTTCTTTGGATTTGCCCAAGGTTAAGAA
CTCAGCCAAAGGGAAGGTTTTGATGCGCGCAATGTATGGGGNTTAAGGTG
TT
back to top