FC920481

Overview
NameFC920481
Unique NameFC920481
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length693
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC920481 vs. ExPASy Swiss-Prot
Match: UXS1_RAT (UDP-glucuronic acid decarboxylase 1 OS=Rattus norvegicus GN=Uxs1 PE=1 SV=1)

HSP 1 Score: 317.775 bits (813), Expect = 9.212e-88
Identity = 151/207 (72.95%), Postives = 175/207 (84.54%), Query Frame = 2
Query:   23 RILVTGGAGFIGSHLVDKLMENEKNEVIVVDNYFTGSKDNLRKWIGHPRFELIRHDVTEPLLIEVDQIYHLACPASPIFYKYNPVKTIKTNVIGTLNMLGLAKRVGARILLTSTSEVYGDPLVHPQDESYWGNVNPIGVRSCYDEGKRVAETLMFDYHRQHGIEIRIARIFNTYGPRMNIDDGRVVSNFIAQAIRGEPLTVQAPGTQ 643
            RIL+TGGAGF+GSHL DKLM  + +EV VVDN+FTG K N+  WIGH  FELI HDV EPL IEVDQIYHLA PASP  Y YNP+KT+KTN IGTLNMLGLAKRVGAR+LL STSEVYGDP VHPQ E YWG+VNPIG R+CYDEGKRVAET+ + Y +Q G+E+R+ARIFNT+GPRM+++DGRVVSNFI QA++GEPLTV   G+Q
Sbjct:   90 RILITGGAGFVGSHLTDKLMM-DGHEVTVVDNFFTGRKRNVEHWIGHENFELINHDVVEPLYIEVDQIYHLASPASPPNYMYNPIKTLKTNTIGTLNMLGLAKRVGARLLLASTSEVYGDPEVHPQSEDYWGHVNPIGPRACYDEGKRVAETMCYAYMKQEGVEVRVARIFNTFGPRMHMNDGRVVSNFILQALQGEPLTVYGSGSQ 295          

HSP 2 Score: 27.7202 bits (60), Expect = 9.212e-88
Identity = 12/21 (57.14%), Postives = 17/21 (80.95%), Query Frame = 1
Query:  631 SWNTTRSFCYVSDMVDGLIRL 693
            S + TR+F YVSD+V+GL+ L
Sbjct:  292 SGSQTRAFQYVSDLVNGLVAL 312          
BLAST of FC920481 vs. ExPASy Swiss-Prot
Match: UXS1_PONAB (UDP-glucuronic acid decarboxylase 1 OS=Pongo abelii GN=UXS1 PE=2 SV=1)

HSP 1 Score: 317.775 bits (813), Expect = 9.212e-88
Identity = 151/207 (72.95%), Postives = 175/207 (84.54%), Query Frame = 2
Query:   23 RILVTGGAGFIGSHLVDKLMENEKNEVIVVDNYFTGSKDNLRKWIGHPRFELIRHDVTEPLLIEVDQIYHLACPASPIFYKYNPVKTIKTNVIGTLNMLGLAKRVGARILLTSTSEVYGDPLVHPQDESYWGNVNPIGVRSCYDEGKRVAETLMFDYHRQHGIEIRIARIFNTYGPRMNIDDGRVVSNFIAQAIRGEPLTVQAPGTQ 643
            RIL+TGGAGF+GSHL DKLM  + +EV VVDN+FTG K N+  WIGH  FELI HDV EPL IEVDQIYHLA PASP  Y YNP+KT+KTN IGTLNMLGLAKRVGAR+LL STSEVYGDP VHPQ E YWG+VNPIG R+CYDEGKRVAET+ + Y +Q G+E+R+ARIFNT+GPRM+++DGRVVSNFI QA++GEPLTV   G+Q
Sbjct:   90 RILITGGAGFVGSHLTDKLMM-DGHEVTVVDNFFTGRKRNVEHWIGHENFELINHDVVEPLYIEVDQIYHLASPASPPNYMYNPIKTLKTNTIGTLNMLGLAKRVGARLLLASTSEVYGDPEVHPQSEDYWGHVNPIGPRACYDEGKRVAETMCYAYMKQEGVEVRVARIFNTFGPRMHMNDGRVVSNFILQALQGEPLTVYGSGSQ 295          

HSP 2 Score: 27.7202 bits (60), Expect = 9.212e-88
Identity = 12/21 (57.14%), Postives = 17/21 (80.95%), Query Frame = 1
Query:  631 SWNTTRSFCYVSDMVDGLIRL 693
            S + TR+F YVSD+V+GL+ L
Sbjct:  292 SGSQTRAFQYVSDLVNGLVAL 312          
BLAST of FC920481 vs. ExPASy Swiss-Prot
Match: UXS1_MOUSE (UDP-glucuronic acid decarboxylase 1 OS=Mus musculus GN=Uxs1 PE=2 SV=1)

HSP 1 Score: 317.775 bits (813), Expect = 9.212e-88
Identity = 151/207 (72.95%), Postives = 175/207 (84.54%), Query Frame = 2
Query:   23 RILVTGGAGFIGSHLVDKLMENEKNEVIVVDNYFTGSKDNLRKWIGHPRFELIRHDVTEPLLIEVDQIYHLACPASPIFYKYNPVKTIKTNVIGTLNMLGLAKRVGARILLTSTSEVYGDPLVHPQDESYWGNVNPIGVRSCYDEGKRVAETLMFDYHRQHGIEIRIARIFNTYGPRMNIDDGRVVSNFIAQAIRGEPLTVQAPGTQ 643
            RIL+TGGAGF+GSHL DKLM  + +EV VVDN+FTG K N+  WIGH  FELI HDV EPL IEVDQIYHLA PASP  Y YNP+KT+KTN IGTLNMLGLAKRVGAR+LL STSEVYGDP VHPQ E YWG+VNPIG R+CYDEGKRVAET+ + Y +Q G+E+R+ARIFNT+GPRM+++DGRVVSNFI QA++GEPLTV   G+Q
Sbjct:   90 RILITGGAGFVGSHLTDKLMM-DGHEVTVVDNFFTGRKRNVEHWIGHENFELINHDVVEPLYIEVDQIYHLASPASPPNYMYNPIKTLKTNTIGTLNMLGLAKRVGARLLLASTSEVYGDPEVHPQSEDYWGHVNPIGPRACYDEGKRVAETMCYAYMKQEGVEVRVARIFNTFGPRMHMNDGRVVSNFILQALQGEPLTVYGSGSQ 295          

HSP 2 Score: 27.7202 bits (60), Expect = 9.212e-88
Identity = 12/21 (57.14%), Postives = 17/21 (80.95%), Query Frame = 1
Query:  631 SWNTTRSFCYVSDMVDGLIRL 693
            S + TR+F YVSD+V+GL+ L
Sbjct:  292 SGSQTRAFQYVSDLVNGLVAL 312          
BLAST of FC920481 vs. ExPASy Swiss-Prot
Match: UXS1_HUMAN (UDP-glucuronic acid decarboxylase 1 OS=Homo sapiens GN=UXS1 PE=1 SV=1)

HSP 1 Score: 317.775 bits (813), Expect = 9.212e-88
Identity = 151/207 (72.95%), Postives = 175/207 (84.54%), Query Frame = 2
Query:   23 RILVTGGAGFIGSHLVDKLMENEKNEVIVVDNYFTGSKDNLRKWIGHPRFELIRHDVTEPLLIEVDQIYHLACPASPIFYKYNPVKTIKTNVIGTLNMLGLAKRVGARILLTSTSEVYGDPLVHPQDESYWGNVNPIGVRSCYDEGKRVAETLMFDYHRQHGIEIRIARIFNTYGPRMNIDDGRVVSNFIAQAIRGEPLTVQAPGTQ 643
            RIL+TGGAGF+GSHL DKLM  + +EV VVDN+FTG K N+  WIGH  FELI HDV EPL IEVDQIYHLA PASP  Y YNP+KT+KTN IGTLNMLGLAKRVGAR+LL STSEVYGDP VHPQ E YWG+VNPIG R+CYDEGKRVAET+ + Y +Q G+E+R+ARIFNT+GPRM+++DGRVVSNFI QA++GEPLTV   G+Q
Sbjct:   90 RILITGGAGFVGSHLTDKLMM-DGHEVTVVDNFFTGRKRNVEHWIGHENFELINHDVVEPLYIEVDQIYHLASPASPPNYMYNPIKTLKTNTIGTLNMLGLAKRVGARLLLASTSEVYGDPEVHPQSEDYWGHVNPIGPRACYDEGKRVAETMCYAYMKQEGVEVRVARIFNTFGPRMHMNDGRVVSNFILQALQGEPLTVYGSGSQ 295          

HSP 2 Score: 27.7202 bits (60), Expect = 9.212e-88
Identity = 12/21 (57.14%), Postives = 17/21 (80.95%), Query Frame = 1
Query:  631 SWNTTRSFCYVSDMVDGLIRL 693
            S + TR+F YVSD+V+GL+ L
Sbjct:  292 SGSQTRAFQYVSDLVNGLVAL 312          
BLAST of FC920481 vs. ExPASy Swiss-Prot
Match: UXS1_XENTR (UDP-glucuronic acid decarboxylase 1 OS=Xenopus tropicalis GN=uxs1 PE=2 SV=1)

HSP 1 Score: 313.923 bits (803), Expect = 1.714e-86
Identity = 150/207 (72.46%), Postives = 173/207 (83.57%), Query Frame = 2
Query:   23 RILVTGGAGFIGSHLVDKLMENEKNEVIVVDNYFTGSKDNLRKWIGHPRFELIRHDVTEPLLIEVDQIYHLACPASPIFYKYNPVKTIKTNVIGTLNMLGLAKRVGARILLTSTSEVYGDPLVHPQDESYWGNVNPIGVRSCYDEGKRVAETLMFDYHRQHGIEIRIARIFNTYGPRMNIDDGRVVSNFIAQAIRGEPLTVQAPGTQ 643
            RIL+TGGAGF+GSHL DKLM  + +EV VVDN+FTG K N+  WIGH  FELI HDV EPL IEVDQIYHLA PASP  Y YNP+KT+KTN IGTLNMLGLAKRVGAR+LL STSEVYGDP VHPQ E YWG+VNPIG R+CYDEGKRVAET+ + Y +Q G+E+R+ARIFNT+GPRM+++DGRVVSNFI QA++GE LTV   G Q
Sbjct:   91 RILITGGAGFVGSHLTDKLMM-DGHEVTVVDNFFTGRKRNVEHWIGHENFELINHDVVEPLYIEVDQIYHLASPASPPNYMYNPIKTLKTNTIGTLNMLGLAKRVGARLLLASTSEVYGDPEVHPQSEEYWGHVNPIGPRACYDEGKRVAETMCYAYMKQEGVEVRVARIFNTFGPRMHMNDGRVVSNFILQALQGEQLTVYGSGEQ 296          

HSP 2 Score: 27.335 bits (59), Expect = 1.714e-86
Identity = 12/21 (57.14%), Postives = 16/21 (76.19%), Query Frame = 1
Query:  631 SWNTTRSFCYVSDMVDGLIRL 693
            S   TR+F YVSD+V+GL+ L
Sbjct:  293 SGEQTRAFQYVSDLVNGLVAL 313          
BLAST of FC920481 vs. ExPASy Swiss-Prot
Match: UXS1_DANRE (UDP-glucuronic acid decarboxylase 1 OS=Danio rerio GN=uxs1 PE=2 SV=2)

HSP 1 Score: 311.997 bits (798), Expect = 4.963e-86
Identity = 149/207 (71.98%), Postives = 174/207 (84.06%), Query Frame = 2
Query:   23 RILVTGGAGFIGSHLVDKLMENEKNEVIVVDNYFTGSKDNLRKWIGHPRFELIRHDVTEPLLIEVDQIYHLACPASPIFYKYNPVKTIKTNVIGTLNMLGLAKRVGARILLTSTSEVYGDPLVHPQDESYWGNVNPIGVRSCYDEGKRVAETLMFDYHRQHGIEIRIARIFNTYGPRMNIDDGRVVSNFIAQAIRGEPLTVQAPGTQ 643
            RIL+TGGAGF+GSHL DKLM  + +EV VVDN+FTG K N+  WIGH  FELI HDV EPL IEVDQIYHLA PASP  Y YNP+KT+KTN IGTLNMLGLAKRVGAR+LL STSEVYGDP VHPQ+E YWG+VNPIG R+CYDEGKRVAET+ + Y +Q G+E+R+ARIFNT+G RM+++DGRVVSNFI QA++GE LTV   G+Q
Sbjct:   88 RILITGGAGFVGSHLTDKLMM-DGHEVTVVDNFFTGRKRNVEHWIGHENFELINHDVVEPLYIEVDQIYHLASPASPPNYMYNPIKTLKTNTIGTLNMLGLAKRVGARLLLASTSEVYGDPEVHPQNEDYWGHVNPIGPRACYDEGKRVAETMCYAYMKQEGVEVRVARIFNTFGSRMHMNDGRVVSNFILQALQGEALTVYGSGSQ 293          

HSP 2 Score: 27.7202 bits (60), Expect = 4.963e-86
Identity = 12/21 (57.14%), Postives = 17/21 (80.95%), Query Frame = 1
Query:  631 SWNTTRSFCYVSDMVDGLIRL 693
            S + TR+F YVSD+V+GL+ L
Sbjct:  290 SGSQTRAFQYVSDLVNGLVSL 310          
BLAST of FC920481 vs. ExPASy Swiss-Prot
Match: GALE_METJA (Putative UDP-glucose 4-epimerase OS=Methanocaldococcus jannaschii GN=MJ0211 PE=3 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 4.210e-23
Identity = 81/233 (34.76%), Postives = 124/233 (53.22%), Query Frame = 2
Query:   26 ILVTGGAGFIGSHLVDKLMENEKNEVIVVDNYFTGSKDNLRKWIGHPRFELIRHDVTEPLLIE------VDQIYHLACPASPIFYKYNPVKTIKTNVIGTLNMLGLAKR--VGARILLTSTSEVYGDPLVHPQDESYWGNVNPIGVRSCYDEGKRVAETLMFDYHRQHGIEIRIARIFNTYGPRMN-IDDGRVVSNFIAQAIRGEPLTVQAPGTQ----LVVSVMSQTWLMAL 685
            ILVTGGAGFIGSH+VDKL+EN   +VI++DN  TG+K+N+     +P+ E +  D+ +  L E      V+ + H A   +      NPV     NV+GT+N+L + ++  +   +  +S   VYG+P   P DE++     PI   S Y   K V E  +  Y+R +GIE  I R  N YG R +   +  V+S FI + ++ +   +   G Q    + V  +++  LMAL
Sbjct:    2 ILVTGGAGFIGSHIVDKLIEN-NYDVIILDNLTTGNKNNI-----NPKAEFVNADIRDKDLDEKINFKDVEVVIHQAAQINVRNSVENPVYDGDINVLGTINILEMMRKYDIDKIVFASSGGAVYGEPNYLPVDENH-----PINPLSPYGLSKYVGEEYIKLYNRLYGIEYAILRYSNVYGERQDPKGEAGVISIFIDKMLKNQSPIIFGDGNQTRDFVYVGDVAKANLMAL 223          
BLAST of FC920481 vs. ExPASy Swiss-Prot
Match: ACBB_ACTS5 (dTDP-glucose 4,6-dehydratase OS=Actinoplanes sp. (strain 50/110) GN=acbB PE=3 SV=2)

HSP 1 Score: 92.8189 bits (229), Expect = 1.830e-18
Identity = 70/223 (31.39%), Postives = 105/223 (47.09%), Query Frame = 2
Query:   20 MRILVTGGAGFIGSHLVDKLMENE------KNEVIVVDNY-FTGSKDNLRKWIGHPRFELIRHDVTEPLLIEV-----DQIYHLACPASPIFYKYNPVKTIKTNVIGTLNMLGLAKR--VGARILLTSTSEVYGDPLVHPQDESYWGNVNPIGVRSCYDEGKRVAETLMFDYHRQHGIEIRIARIFNTYGPRMNIDDGRVVSNFIAQAIRGEPLTVQAPGTQL 646
            M+ILVTGGAGFIGSH V  L+  +        +V VVD   + G+  NL +    PRF  +R D+ +  LIE      D + H A               + +N++GT  +L  A R  +G R L  ST EVYG       D   W   +P+   S Y   K  ++ L   YH+ HG+++ + R  N YGPR   +  +++  F+ + + G  + V   G  +
Sbjct:    1 MKILVTGGAGFIGSHFVTSLISGDIATPQPVTQVTVVDKLGYGGNLRNLAEASADPRFSFVRGDICDEGLIEGLMARHDTVAHFAAETHVDRSVVASGPFVASNLVGTQVLLDAALRHHIG-RFLHVSTDEVYGSI-----DTGSWAEGHPLAPNSPYAASKAGSDLLALAYHQTHGMDVVVTRCSNNYGPRQFPE--KMIPLFVTRLLDGLDVPVYGDGRNI 215          
BLAST of FC920481 vs. ExPASy Swiss-Prot
Match: ARNA_PECCP (Bifunctional polymyxin resistance protein arnA OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=arnA PE=3 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 1.186e-17
Identity = 64/222 (28.83%), Postives = 110/222 (49.55%), Query Frame = 2
Query:   23 RILVTGGAGFIGSHLVDKLMENEKNEVIVVDNYFTGSKDNLRKWIGHPRFELIRHDVT------EPLLIEVDQIYHLACPASPIFYKYNPVKTIKTNVIGTLNMLGLAKRVGARILLTSTSEVYG--DPLVHPQDESYWGNVNPIG-VRSCYDEGKRVAETLMFDYHRQHGIEIRIARIFNTYGPRMN------IDDGRVVSNFIAQAIRGEPLTVQAPGTQ 643
            R+L+ G  GFIG+HL ++L+ +++ E+  +D     S D + +++G PRF  +  D++      E  + + D I  L   A+PI Y  NP++  + +    L ++    R   RI+  STSEVYG  D     +D S    V PI   R  Y   K++ + +++ Y  ++G+   + R FN  GPR++      I   R ++  I   + G P+ +   G Q
Sbjct:  323 RVLILGVNGFIGNHLTERLLRDDRYEIYGLDI----SSDAIARFLGDPRFHFVEGDISIHNEWIEYHIKKCDVILPLVAIATPIEYTRNPLRVFELDFEENLKIVRDCVRYNKRIVFPSTSEVYGMCDDKEFDEDTSRL-IVGPINKQRWIYSVSKQLLDRVIWAYGAKNGLRFTLFRPFNWMGPRLDTLDAARIGSSRAITQLILNLVEGSPIKLVDGGAQ 539          
BLAST of FC920481 vs. ExPASy Swiss-Prot
Match: ARNA_ERWCT (Bifunctional polymyxin resistance protein arnA OS=Erwinia carotovora subsp. atroseptica GN=arnA PE=3 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 1.186e-17
Identity = 64/222 (28.83%), Postives = 110/222 (49.55%), Query Frame = 2
Query:   23 RILVTGGAGFIGSHLVDKLMENEKNEVIVVDNYFTGSKDNLRKWIGHPRFELIRHDVT------EPLLIEVDQIYHLACPASPIFYKYNPVKTIKTNVIGTLNMLGLAKRVGARILLTSTSEVYG--DPLVHPQDESYWGNVNPIG-VRSCYDEGKRVAETLMFDYHRQHGIEIRIARIFNTYGPRMN------IDDGRVVSNFIAQAIRGEPLTVQAPGTQ 643
            R+L+ G  GFIG+HL ++L+ +++ E+  +D     S D + +++G PRF  +  D++      E  + + D I  L   A+PI Y  NP++  + +    L ++    R   RI+  STSEVYG  D     +D S    V PI   R  Y   K++ + +++ Y  ++G+   + R FN  GPR++      I   R ++  I   + G P+ +   G Q
Sbjct:  324 RVLILGVNGFIGNHLTERLLRDDRYEIYGLDI----SSDAIARFLGDPRFHFVEGDISIHNEWIEYHIKKCDVILPLVAIATPIEYTRNPLRVFELDFEENLKIVRDCVRYNKRIVFPSTSEVYGMCDDKEFDEDTSRL-IVGPINKQRWIYSVSKQLLDRVIWAYGAKNGLRFTLFRPFNWMGPRLDTLDAARIGSSRAITQLILNLVEGSPIKLVDGGAQ 540          
The following BLAST results are available for this feature:
BLAST of FC920481 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 111
Match NameE-valueIdentityDescription
UXS1_RAT9.212e-8872.95UDP-glucuronic acid decarboxylase 1 OS=Rattus norv... [more]
UXS1_PONAB9.212e-8872.95UDP-glucuronic acid decarboxylase 1 OS=Pongo abeli... [more]
UXS1_MOUSE9.212e-8872.95UDP-glucuronic acid decarboxylase 1 OS=Mus musculu... [more]
UXS1_HUMAN9.212e-8872.95UDP-glucuronic acid decarboxylase 1 OS=Homo sapien... [more]
UXS1_XENTR1.714e-8672.46UDP-glucuronic acid decarboxylase 1 OS=Xenopus tro... [more]
UXS1_DANRE4.963e-8671.98UDP-glucuronic acid decarboxylase 1 OS=Danio rerio... [more]
GALE_METJA4.210e-2334.76Putative UDP-glucose 4-epimerase OS=Methanocaldoco... [more]
ACBB_ACTS51.830e-1831.39dTDP-glucose 4,6-dehydratase OS=Actinoplanes sp. (... [more]
ARNA_PECCP1.186e-1728.83Bifunctional polymyxin resistance protein arnA OS=... [more]
ARNA_ERWCT1.186e-1728.83Bifunctional polymyxin resistance protein arnA OS=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32008H11EF RVDevelop1 Citrus clementina cDNA clone C32008H11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920481 ID=FC920481|Name=FC920481|organism=Citrus clementina|type=EST|length=693bp
CAAATTTTTTCAGTCCAACATGAGGATTCTGGTTACTGGAGGAGCTGGAT
TTATCGGCTCTCACCTTGTGGACAAGTTGATGGAAAATGAAAAGAACGAG
GTGATTGTAGTTGATAACTACTTCACTGGCTCAAAGGATAACCTAAGGAA
ATGGATTGGTCACCCAAGATTTGAGCTTATTCGTCATGATGTGACTGAGC
CATTGTTGATCGAGGTTGATCAAATTTATCACCTTGCTTGTCCTGCCTCC
CCAATCTTCTACAAATACAACCCTGTAAAGACTATAAAGACAAATGTGAT
TGGTACATTGAACATGCTGGGGCTTGCCAAGCGAGTCGGAGCTAGGATTT
TGCTTACATCAACTTCAGAGGTTTACGGAGATCCTCTTGTGCATCCCCAG
GATGAGAGCTATTGGGGAAATGTGAACCCAATTGGAGTCAGGAGTTGCTA
TGATGAGGGAAAAAGAGTTGCAGAAACTTTGATGTTTGACTACCATCGGC
AGCATGGGATTGAGATAAGGATTGCTAGGATTTTCAACACCTATGGACCC
CGCATGAATATTGATGATGGTCGTGTTGTCAGCAATTTTATTGCTCAAGC
AATCCGTGGCGAACCCTTGACTGTTCAAGCTCCTGGAACACAACTCGTAG
TTTCTGTTATGTCTCAGACATGGTTGATGGCCTTATTCGGCTT
back to top