FC920648

Overview
NameFC920648
Unique NameFC920648
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length687
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14142 contig Ccv1_Contig14142:258..944. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920648 vs. ExPASy Swiss-Prot
Match: P4HA1_RAT (Prolyl 4-hydroxylase subunit alpha-1 OS=Rattus norvegicus GN=P4ha1 PE=2 SV=2)

HSP 1 Score: 80.8777 bits (198), Expect = 7.136e-15
Identity = 48/148 (32.43%), Postives = 79/148 (53.38%), Query Frame = 1
Query:  151 IINPSKVKQISWKPRAFVYEGFLTDLECDHLINLAKSQLKRSAVADNLSGESKLSDVRTSSGTFIPKGKDAIIAGIEDKIATWTFLPKENGEDIQVLRCEHGQKYEPHYDYF----SDKVNIVRGGHRLATVLMYLSDVAKGGETVFP 582
            I+ P+K +    KPR   +   ++D E + + +LAK +L R+ V D  +G+   +  R S   ++   +D +++ I  +I   T L     E++QV     G +YEPH+D+      D    +  G+R+AT L Y+SDV+ GG TVFP
Sbjct:  322 ILAPAKQEDEWDKPRIIRFHDIISDAEIEIVKDLAKPRLSRATVHDPETGKLTTAQYRVSKSAWLSGYEDPVVSRINMRIQDLTGLDVSTAEELQVANYGVGGQYEPHFDFARKDEPDAFRELGTGNRIATWLFYMSDVSAGGATVFP 469          
BLAST of FC920648 vs. ExPASy Swiss-Prot
Match: P4HA1_MOUSE (Prolyl 4-hydroxylase subunit alpha-1 OS=Mus musculus GN=P4ha1 PE=2 SV=2)

HSP 1 Score: 80.1073 bits (196), Expect = 1.217e-14
Identity = 46/148 (31.08%), Postives = 81/148 (54.73%), Query Frame = 1
Query:  151 IINPSKVKQISWKPRAFVYEGFLTDLECDHLINLAKSQLKRSAVADNLSGESKLSDVRTSSGTFIPKGKDAIIAGIEDKIATWTFLPKENGEDIQVLRCEHGQKYEPHYDYF----SDKVNIVRGGHRLATVLMYLSDVAKGGETVFP 582
            I+ P+K +    KPR   +   ++D E + + +LAK +L+R+ +++ ++G  +    R S   ++   +D +++ I  +I   T L     E++QV     G +YEPH+D+      D    +  G+R+AT L Y+SDV+ GG TVFP
Sbjct:  322 ILAPAKQEDEWDKPRIIRFHDIISDAEIEIVKDLAKPRLRRATISNPVTGALETVHYRISKSAWLSGYEDPVVSRINMRIQDLTGLDVSTAEELQVANYGVGGQYEPHFDFARKDEPDAFRELGTGNRIATWLFYMSDVSAGGATVFP 469          
BLAST of FC920648 vs. ExPASy Swiss-Prot
Match: P4HA1_PONAB (Prolyl 4-hydroxylase subunit alpha-1 OS=Pongo abelii GN=P4HA1 PE=2 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.590e-14
Identity = 45/148 (30.41%), Postives = 82/148 (55.41%), Query Frame = 1
Query:  151 IINPSKVKQISWKPRAFVYEGFLTDLECDHLINLAKSQLKRSAVADNLSGESKLSDVRTSSGTFIPKGKDAIIAGIEDKIATWTFLPKENGEDIQVLRCEHGQKYEPHYDYF----SDKVNIVRGGHRLATVLMYLSDVAKGGETVFP 582
            I+ P+K +    KPR   +   ++D E + + +LAK +L+R+ +++ ++G+ +    R S   ++   ++ +++ I  +I   T L     E++QV     G +YEPH+D+      D    +  G+R+AT L Y+SDV+ GG TVFP
Sbjct:  322 ILAPAKQEDEWDKPRIIRFHDIISDAEIEIVKDLAKPRLRRATISNPITGDLETVHYRISKSAWLSGYENPVVSRINMRIQDLTGLDVSTAEELQVANYGVGGQYEPHFDFARKDEPDAFKELGTGNRIATWLFYMSDVSAGGATVFP 469          
BLAST of FC920648 vs. ExPASy Swiss-Prot
Match: P4HA1_HUMAN (Prolyl 4-hydroxylase subunit alpha-1 OS=Homo sapiens GN=P4HA1 PE=1 SV=2)

HSP 1 Score: 79.7221 bits (195), Expect = 1.590e-14
Identity = 45/148 (30.41%), Postives = 82/148 (55.41%), Query Frame = 1
Query:  151 IINPSKVKQISWKPRAFVYEGFLTDLECDHLINLAKSQLKRSAVADNLSGESKLSDVRTSSGTFIPKGKDAIIAGIEDKIATWTFLPKENGEDIQVLRCEHGQKYEPHYDYF----SDKVNIVRGGHRLATVLMYLSDVAKGGETVFP 582
            I+ P+K +    KPR   +   ++D E + + +LAK +L+R+ +++ ++G+ +    R S   ++   ++ +++ I  +I   T L     E++QV     G +YEPH+D+      D    +  G+R+AT L Y+SDV+ GG TVFP
Sbjct:  322 ILAPAKQEDEWDKPRIIRFHDIISDAEIEIVKDLAKPRLRRATISNPITGDLETVHYRISKSAWLSGYENPVVSRINMRIQDLTGLDVSTAEELQVANYGVGGQYEPHFDFARKDEPDAFKELGTGNRIATWLFYMSDVSAGGATVFP 469          
BLAST of FC920648 vs. ExPASy Swiss-Prot
Match: P4HA1_BOVIN (Prolyl 4-hydroxylase subunit alpha-1 OS=Bos taurus GN=P4HA1 PE=1 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.712e-14
Identity = 45/148 (30.41%), Postives = 81/148 (54.73%), Query Frame = 1
Query:  151 IINPSKVKQISWKPRAFVYEGFLTDLECDHLINLAKSQLKRSAVADNLSGESKLSDVRTSSGTFIPKGKDAIIAGIEDKIATWTFLPKENGEDIQVLRCEHGQKYEPHYDYF----SDKVNIVRGGHRLATVLMYLSDVAKGGETVFP 582
            I+ P+K +    KPR   +   ++D E + + +LAK +L+R+ +++ ++G+ +    R S   ++   ++ +++ I  +I   T L     E++QV     G +YEPH+D+      D    +  G+R+AT L Y+SDV  GG TVFP
Sbjct:  322 ILAPAKQEDEWDKPRIIRFHDIISDAEIEVVKDLAKPRLRRATISNPITGDLETVHYRISKSAWLSGYENPVVSRINMRIQDLTGLDVSTAEELQVANYGVGGQYEPHFDFARKDEPDAFKELGTGNRIATWLFYMSDVLAGGATVFP 469          
BLAST of FC920648 vs. ExPASy Swiss-Prot
Match: P4HA2_CHICK (Prolyl 4-hydroxylase subunit alpha-2 OS=Gallus gallus GN=P4HA2 PE=2 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 2.296e-13
Identity = 46/147 (31.29%), Postives = 76/147 (51.70%), Query Frame = 1
Query:  151 IINPSKVKQISWKPRAFVYEGFLTDLECDHLINLAKSQLKRSAVADNLSGESKLSDVRTSSGTFIPKGKDAIIAGIEDKIATWTFLPKENGEDIQVLRCEHGQKYEPHYDYFSDKVN--IVRGGHRLATVLMYLSDVAKGGETVFPN 585
            +I P K +     P    Y   ++D E + +  LAK +L R+ V D  +G   ++  R S  +++ +  D ++A +  ++   T L  +  E +QV     G +YEPH+D+     +  +   G+RLAT L Y+SDV  GG TVFP+
Sbjct:  324 LIAPFKEEDEWDSPHIVRYYDVMSDEEIEKIKQLAKPKLARATVRDPKTGVLTVASYRVSKSSWLEEDDDPVVAKVNQRMQQITGLTVKTAELLQVANYGMGGQYEPHFDFSRRPFDSTLKSEGNRLATFLNYMSDVEAGGATVFPD 470          
BLAST of FC920648 vs. ExPASy Swiss-Prot
Match: P4HA2_CAEEL (Prolyl 4-hydroxylase subunit alpha-2 OS=Caenorhabditis elegans GN=phy-2 PE=1 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 2.296e-13
Identity = 43/144 (29.86%), Postives = 77/144 (53.47%), Query Frame = 1
Query:  160 PSKVKQISWKPRAFVYEGFLTDLECDHLINLAKSQLKRSAVADNLSGESKLSDVRTSSGTFIPKGKDAIIAGIEDKIATWTFLPKENGEDIQVLRCEHGQKYEPHYDYF----SDKVNIVRGGHRLATVLMYLSDVAKGGETVF 579
            P KV+ + + P A +++  + D E + +  LA  +LKR+ V ++ +GE + +  R S   ++    D +I  +  +I  +T L +   E++QV     G  Y+PH+D+      +    +  G+R+ATVL Y+S   +GG TVF
Sbjct:  315 PIKVEILRFDPLAVLFKNVIHDSEIEVIKELASPKLKRATVQNSKTGELEHATYRISKSAWLKGDLDPVIDRVNRRIEDFTNLNQATSEELQVANYGLGGHYDPHFDFARKEEKNAFKTLNTGNRIATVLFYMSQPERGGATVF 458          
BLAST of FC920648 vs. ExPASy Swiss-Prot
Match: P4HA1_CHICK (Prolyl 4-hydroxylase subunit alpha-1 OS=Gallus gallus GN=P4HA1 PE=1 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 2.296e-13
Identity = 47/148 (31.76%), Postives = 76/148 (51.35%), Query Frame = 1
Query:  151 IINPSKVKQISWKPRAFVYEGFLTDLECDHLINLAKSQLKRSAVADNLSGESKLSDVRTSSGTFIPKGKDAIIAGIEDKIATWTFLPKENGEDIQVLRCEHGQKYEPHYDY----FSDKVNIVRGGHRLATVLMYLSDVAKGGETVFP 582
            I+ P K +    KPR   +   ++D E + +  LAK +L R+ V D  +G+   +  R S   ++   +  +++ I  +I   T L     E++QV     G +YEPH+D+      D    +  G+R+AT L Y+SDV+ GG TVFP
Sbjct:  304 ILGPVKQEDEWDKPRIVRFLDIISDEEIETVKELAKPRLSRATVHDPETGKLTTAHYRVSKSAWLSGYESPVVSRINTRIQDLTGLDVSTAEELQVANYGVGGQYEPHFDFGRKDEPDAFKELGTGNRIATWLFYMSDVSAGGATVFP 451          
BLAST of FC920648 vs. ExPASy Swiss-Prot
Match: P4HA2_MOUSE (Prolyl 4-hydroxylase subunit alpha-2 OS=Mus musculus GN=P4ha2 PE=2 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 6.679e-13
Identity = 45/149 (30.20%), Postives = 76/149 (51.01%), Query Frame = 1
Query:  151 IINPSKVKQISWKPRAFVYEGFLTDLECDHLINLAKSQLKRSAVADNLSGESKLSDVRTSSGTFIPKGKDAIIAGIEDKIATWTFLPKENGEDIQVLRCEHGQKYEPHYDYF----SDKVNIVRGGHRLATVLMYLSDVAKGGETVFPN 585
            +I P K +     P    Y   ++D E + +  +AK +L R+ V D  +G   ++  R S  +++ +  D ++A +  ++   T L  +  E +QV     G +YEPH+D+      D    +  G+R+AT L Y+SDV  GG TVFP+
Sbjct:  325 LIAPFKEEDEWDSPHIVRYYDVMSDEEIERIKEIAKPKLARATVRDPKTGVLTVASYRVSKSSWLEEDDDPVVARVNRRMQHITGLTVKTAELLQVANYGMGGQYEPHFDFSRSDDEDAFKRLGTGNRVATFLNYMSDVEAGGATVFPD 473          
BLAST of FC920648 vs. ExPASy Swiss-Prot
Match: P4HA1_CAEEL (Prolyl 4-hydroxylase subunit alpha-1 OS=Caenorhabditis elegans GN=dpy-18 PE=1 SV=2)

HSP 1 Score: 74.3294 bits (181), Expect = 6.679e-13
Identity = 47/162 (29.01%), Postives = 82/162 (50.62%), Query Frame = 1
Query:  160 PSKVKQISWKPRAFVYEGFLTDLECDHLINLAKSQLKRSAVADNLSGESKLSDVRTSSGTFIPKGKDAIIAGIEDKIATWTFLPKENGEDIQVLRCEHGQKYEPHYDYF----SDKVNIVRGGHRLATVLMYLSDVAKGGETVFPNAEEPPRRRTPATNDDL 633
            P KV+   + P A +++  ++D E   +  LAK +L R+ V D+++G+   +  R S   ++ + +  ++  +  +I   T L  E  E++Q+     G  Y+PH+D+     S     +  G+R+ATVL Y+S  + GG TVF  A+       P  ND L
Sbjct:  318 PIKVEIKRFNPLAVLFKDVISDDEVAAIQELAKPKLARATVHDSVTGKLVTATYRISKSAWLKEWEGDVVETVNKRIGYMTNLEMETAEELQIANYGIGGHYDPHFDHAKKEESKSFESLGTGNRIATVLFYMSQPSHGGGTVFTEAKS---TILPTKNDAL 476          
The following BLAST results are available for this feature:
BLAST of FC920648 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 14
Match NameE-valueIdentityDescription
P4HA1_RAT7.136e-1532.43Prolyl 4-hydroxylase subunit alpha-1 OS=Rattus nor... [more]
P4HA1_MOUSE1.217e-1431.08Prolyl 4-hydroxylase subunit alpha-1 OS=Mus muscul... [more]
P4HA1_PONAB1.590e-1430.41Prolyl 4-hydroxylase subunit alpha-1 OS=Pongo abel... [more]
P4HA1_HUMAN1.590e-1430.41Prolyl 4-hydroxylase subunit alpha-1 OS=Homo sapie... [more]
P4HA1_BOVIN2.712e-1430.41Prolyl 4-hydroxylase subunit alpha-1 OS=Bos taurus... [more]
P4HA2_CHICK2.296e-1331.29Prolyl 4-hydroxylase subunit alpha-2 OS=Gallus gal... [more]
P4HA2_CAEEL2.296e-1329.86Prolyl 4-hydroxylase subunit alpha-2 OS=Caenorhabd... [more]
P4HA1_CHICK2.296e-1331.76Prolyl 4-hydroxylase subunit alpha-1 OS=Gallus gal... [more]
P4HA2_MOUSE6.679e-1330.20Prolyl 4-hydroxylase subunit alpha-2 OS=Mus muscul... [more]
P4HA1_CAEEL6.679e-1329.01Prolyl 4-hydroxylase subunit alpha-1 OS=Caenorhabd... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32011C04EF RVDevelop1 Citrus clementina cDNA clone C32011C04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920648 ID=FC920648|Name=FC920648|organism=Citrus clementina|type=EST|length=687bp
GGAGTTTAACATTTTGTCGGATAATCTCAAATCCCTCGTCTCTCATAATC
GATCCAATCCACGCTCATGTCTCCCACAAGGCTCTCTCTAAATTTCTTCT
TCCTGCTCTCCTTCTCGTTGTTAATTCGCAAATCTTTCAGCTCTACCGCC
ATTATCAACCCATCTAAAGTCAAACAAATTTCTTGGAAACCCAGGGCCTT
TGTGTACGAGGGTTTTCTCACAGACTTAGAATGCGATCACTTGATTAATC
TTGCAAAATCTCAGCTGAAGAGATCAGCAGTTGCTGATAATTTGAGTGGA
GAGAGCAAGCTGAGCGATGTTCGAACAAGTTCTGGGACCTTTATACCTAA
AGGAAAGGATGCTATTATTGCTGGTATAGAGGACAAGATTGCAACATGGA
CGTTTCTTCCAAAAGAAAATGGGGAAGACATACAAGTACTAAGGTGTGAG
CACGGACAGAAATATGAACCACATTATGATTACTTCTCTGACAAGGTTAA
TATTGTTCGGGGCGGACACCGCCTAGCAACTGTGCTAATGTATCTTTCCG
ATGTTGCTAAAGGTGGTGAGACAGTATTTCCCAATGCTGAGGAACCTCCA
CGTCGCAGAACTCCTGCTACCAATGACGATCTTTCTGAATGTGCTAAGAA
AGGAATTGCAGTGAAGCCACGAAGAAGGGATGCTCTT
back to top