FC920664

Overview
NameFC920664
Unique NameFC920664
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length339
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10212 contig Ccv1_Contig10212:291..629. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP71_ARATH (Heat shock cognate 70 kDa protein 1 OS=Arabidopsis thaliana GN=HSC70-1 PE=1 SV=3)

HSP 1 Score: 204.527 bits (519), Expect = 1.344e-52
Identity = 103/112 (91.96%), Postives = 106/112 (94.64%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNP NTVFDAKRLIGRRFSD+SVQ DMKLWPFK+ AGPADKPMI V YKGEEK+FAAEEISSMVLIKMREIAEAYLG TIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV
Sbjct:   62 VAMNPVNTVFDAKRLIGRRFSDSSVQSDMKLWPFKIQAGPADKPMIYVEYKGEEKEFAAEEISSMVLIKMREIAEAYLGVTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 173          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP72_SOLLC (Heat shock cognate 70 kDa protein 2 OS=Solanum lycopersicum GN=HSC-2 PE=2 SV=1)

HSP 1 Score: 199.904 bits (507), Expect = 3.309e-51
Identity = 100/112 (89.29%), Postives = 105/112 (93.75%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNP NTVFDAKRLIGRRFSDASVQ DMKLWPFKVI GP DKPMI VNYKGEEKQF+AEEISSMVLIKM+EIAEA+LG T+KNAVVTVPAY NDSQRQATKDAGVI+GLNV
Sbjct:   62 VAMNPINTVFDAKRLIGRRFSDASVQSDMKLWPFKVIPGPGDKPMIVVNYKGEEKQFSAEEISSMVLIKMKEIAEAFLGTTVKNAVVTVPAYSNDSQRQATKDAGVISGLNV 173          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP7C_PETHY (Heat shock cognate 70 kDa protein OS=Petunia hybrida GN=HSP70 PE=2 SV=1)

HSP 1 Score: 199.519 bits (506), Expect = 4.322e-51
Identity = 101/112 (90.18%), Postives = 103/112 (91.96%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNP NTVFDAKRLIGRRFSD SVQ D+KLWPFKVI GP DKPMI V YKGEEKQFAAEEISSMVL KM+EIAEAYLG TIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV
Sbjct:   62 VAMNPINTVFDAKRLIGRRFSDPSVQSDIKLWPFKVIPGPGDKPMIVVTYKGEEKQFAAEEISSMVLTKMKEIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 173          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP7E_SPIOL (Chloroplast envelope membrane 70 kDa heat shock-related protein OS=Spinacia oleracea GN=SCE70 PE=1 SV=3)

HSP 1 Score: 198.364 bits (503), Expect = 9.629e-51
Identity = 99/112 (88.39%), Postives = 106/112 (94.64%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNP NTVFDAKRLIGRRFSDASVQ DMK  PFKV++GP +KPMIGVNYKGEEKQFAAEEISSMVL KM+EIAEAYLG+T+KNAVVTVPAYFNDSQRQATKDAGVI+GLNV
Sbjct:   62 VAMNPINTVFDAKRLIGRRFSDASVQADMKHRPFKVVSGPGEKPMIGVNYKGEEKQFAAEEISSMVLTKMKEIAEAYLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNV 173          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP71_SOLLC (Heat shock cognate 70 kDa protein 1 OS=Solanum lycopersicum GN=HSC-I PE=2 SV=1)

HSP 1 Score: 197.208 bits (500), Expect = 2.145e-50
Identity = 98/112 (87.50%), Postives = 105/112 (93.75%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VA+NP NTVFDAKRLIGRRFSDASVQ DMKLWPFKVI GP DKPMI V YKGEEK+FAAEEISSMVL KM+EIAEA+LG+T+KNAVVTVPAYFNDSQRQATKDAGVI+GLNV
Sbjct:   62 VALNPINTVFDAKRLIGRRFSDASVQEDMKLWPFKVIPGPGDKPMIVVTYKGEEKEFAAEEISSMVLTKMKEIAEAFLGSTVKNAVVTVPAYFNDSQRQATKDAGVISGLNV 173          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP72_ARATH (Heat shock cognate 70 kDa protein 2 OS=Arabidopsis thaliana GN=HSC70-2 PE=2 SV=2)

HSP 1 Score: 195.667 bits (496), Expect = 6.241e-50
Identity = 98/112 (87.50%), Postives = 104/112 (92.86%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNP NTVFDAKRLIGRRFSDASVQ D +LWPF +I+G A+KPMI V YKGEEKQFAAEEISSMVLIKMREIAEA+LG T+KNAVVTVPAYFNDSQRQATKDAGVIAGLNV
Sbjct:   62 VAMNPVNTVFDAKRLIGRRFSDASVQSDRQLWPFTIISGTAEKPMIVVEYKGEEKQFAAEEISSMVLIKMREIAEAFLGTTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 173          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP73_ARATH (Heat shock cognate 70 kDa protein 3 OS=Arabidopsis thaliana GN=HSC70-3 PE=1 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 8.151e-50
Identity = 96/112 (85.71%), Postives = 106/112 (94.64%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNP NTVFDAKRLIGRRF+D+SVQ D+KLWPF + +GPA+KPMI VNYKGE+K+F+AEEISSM+LIKMREIAEAYLG TIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV
Sbjct:   62 VAMNPINTVFDAKRLIGRRFTDSSVQSDIKLWPFTLKSGPAEKPMIVVNYKGEDKEFSAEEISSMILIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 173          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP70_SOYBN (Heat shock 70 kDa protein OS=Glycine max GN=HSP70 PE=3 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 1.177e-48
Identity = 94/112 (83.93%), Postives = 102/112 (91.07%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNP NTVFDAKRLIGRRFSD+SVQ DMKLWPFKV   P DKPMI VNYKGEEK+F+AEEISSMVL+KMRE+AEA+LG  +KNAVVTVPAYFNDSQRQATKDAG I+GLNV
Sbjct:   61 VAMNPQNTVFDAKRLIGRRFSDSSVQNDMKLWPFKVGGSPCDKPMIVVNYKGEEKKFSAEEISSMVLVKMREVAEAFLGHAVKNAVVTVPAYFNDSQRQATKDAGAISGLNV 172          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP70_MAIZE (Heat shock 70 kDa protein OS=Zea mays GN=HSP70 PE=3 SV=2)

HSP 1 Score: 184.496 bits (467), Expect = 1.439e-46
Identity = 96/112 (85.71%), Postives = 101/112 (90.18%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNPTNTVFDAKRLIGRRFS  +VQ  MKLWP + + G  DKPMI  NYKGEEKQFAAEEISSMVLIKM+EIAEAYLG+TIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV
Sbjct:   61 VAMNPTNTVFDAKRLIGRRFSSPAVQSSMKLWPSRHL-GLGDKPMIVFNYKGEEKQFAAEEISSMVLIKMKEIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 171          
BLAST of FC920664 vs. ExPASy Swiss-Prot
Match: HSP70_DAUCA (Heat shock 70 kDa protein OS=Daucus carota GN=HSP70 PE=3 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 2.454e-46
Identity = 92/112 (82.14%), Postives = 100/112 (89.29%), Query Frame = 2
Query:    2 VAMNPTNTVFDAKRLIGRRFSDASVQGDMKLWPFKVIAGPADKPMIGVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGATIKNAVVTVPAYFNDSQRQATKDAGVIAGLNV 337
            VAMNP+NTVFDAKRLIGRRF+  SVQ DMKLWP +VI GP +KPMI VNYKGE KQFAAEEISSMVLIKM EIAEA+LG ++ +AVVTVPAYFNDSQRQATKD GVIAGLNV
Sbjct:   60 VAMNPSNTVFDAKRLIGRRFNHPSVQSDMKLWPLQVIPGPGEKPMIVVNYKGESKQFAAEEISSMVLIKMLEIAEAFLGHSVNDAVVTVPAYFNDSQRQATKDTGVIAGLNV 171          
The following BLAST results are available for this feature:
BLAST of FC920664 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
HSP71_ARATH1.344e-5291.96Heat shock cognate 70 kDa protein 1 OS=Arabidopsis... [more]
HSP72_SOLLC3.309e-5189.29Heat shock cognate 70 kDa protein 2 OS=Solanum lyc... [more]
HSP7C_PETHY4.322e-5190.18Heat shock cognate 70 kDa protein OS=Petunia hybri... [more]
HSP7E_SPIOL9.629e-5188.39Chloroplast envelope membrane 70 kDa heat shock-re... [more]
HSP71_SOLLC2.145e-5087.50Heat shock cognate 70 kDa protein 1 OS=Solanum lyc... [more]
HSP72_ARATH6.241e-5087.50Heat shock cognate 70 kDa protein 2 OS=Arabidopsis... [more]
HSP73_ARATH8.151e-5085.71Heat shock cognate 70 kDa protein 3 OS=Arabidopsis... [more]
HSP70_SOYBN1.177e-4883.93Heat shock 70 kDa protein OS=Glycine max GN=HSP70 ... [more]
HSP70_MAIZE1.439e-4685.71Heat shock 70 kDa protein OS=Zea mays GN=HSP70 PE=... [more]
HSP70_DAUCA2.454e-4682.14Heat shock 70 kDa protein OS=Daucus carota GN=HSP7... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32011D10EF RVDevelop1 Citrus clementina cDNA clone C32011D10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920664 ID=FC920664|Name=FC920664|organism=Citrus clementina|type=EST|length=339bp
GGTCGCCATGAACCCCACGAACACCGTCTTTGATGCAAAGAGGTTGATTG
GTAGGAGATTCAGCGATGCATCAGTCCAAGGCGATATGAAGCTATGGCCA
TTTAAGGTGATTGCTGGACCTGCTGACAAGCCCATGATTGGTGTTAACTA
CAAGGGCGAAGAGAAGCAGTTTGCTGCTGAGGAAATCTCGTCTATGGTGC
TCATCAAGATGCGTGAGATTGCTGAGGCTTACCTTGGCGCAACTATTAAG
AATGCAGTCGTTACTGTCCCTGCTTACTTCAATGACTCACAGAGGCAGGC
CACCAAGGATGCCGGTGTCATTGCTGGGCTTAATGTGAT
back to top