FC920668

Overview
NameFC920668
Unique NameFC920668
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length688
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10260 contig Ccv1_Contig10260:6..694. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920668 vs. ExPASy Swiss-Prot
Match: CHS2_CITSI (Chalcone synthase 2 OS=Citrus sinensis GN=CHS2 PE=2 SV=1)

HSP 1 Score: 368.237 bits (944), Expect = 8.266e-112
Identity = 181/182 (99.45%), Postives = 182/182 (100.00%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 598
            MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN+
Sbjct:    1 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 57.3806 bits (137), Expect = 8.266e-112
Identity = 27/28 (96.43%), Postives = 28/28 (100.00%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDSL 678
            +GARVLVVCSEITAVTFRGPADTHLDSL
Sbjct:  182 KGARVLVVCSEITAVTFRGPADTHLDSL 209          
BLAST of FC920668 vs. ExPASy Swiss-Prot
Match: CHS2_RUTGR (Chalcone synthase 2 OS=Ruta graveolens GN=CHS2 PE=2 SV=1)

HSP 1 Score: 346.665 bits (888), Expect = 2.437e-105
Identity = 169/180 (93.89%), Postives = 174/180 (96.67%), Query Frame = 2
Query:   59 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 598
            TV+EIR AQRADGPA VLAIGTATPA+ V QADYPDYYFRITKSEHMTELKEKFKRMCDKSMI+KRYMYLTE+ILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPG DYQLTKL+GLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR
Sbjct:    5 TVEEIRKAQRADGPAAVLAIGTATPANYVTQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIRKRYMYLTEDILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGCDYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 184          

HSP 2 Score: 57.3806 bits (137), Expect = 2.437e-105
Identity = 27/28 (96.43%), Postives = 28/28 (100.00%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDSL 678
            +GARVLVVCSEITAVTFRGPADTHLDSL
Sbjct:  184 RGARVLVVCSEITAVTFRGPADTHLDSL 211          
BLAST of FC920668 vs. ExPASy Swiss-Prot
Match: CHS3_RUTGR (Chalcone synthase 3 OS=Ruta graveolens GN=CHS3 PE=2 SV=1)

HSP 1 Score: 346.665 bits (888), Expect = 7.061e-105
Identity = 169/180 (93.89%), Postives = 175/180 (97.22%), Query Frame = 2
Query:   59 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 598
            TV+EIR AQRADGPATVLAIGTATPA+ V QADYPDYYFRITKSEHMT+LKEKFKRMCDKSMI+KRYM+LTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPG DYQLTKL+GLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR
Sbjct:    5 TVEEIRKAQRADGPATVLAIGTATPANYVTQADYPDYYFRITKSEHMTDLKEKFKRMCDKSMIRKRYMHLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAAKAIKEWGQPKSKITHLIFCTTSGVDMPGCDYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 184          

HSP 2 Score: 55.8398 bits (133), Expect = 7.061e-105
Identity = 26/28 (92.86%), Postives = 27/28 (96.43%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDSL 678
            +GARVLVVCSEITAVTFRGP DTHLDSL
Sbjct:  184 RGARVLVVCSEITAVTFRGPVDTHLDSL 211          
BLAST of FC920668 vs. ExPASy Swiss-Prot
Match: CHS1_RUTGR (Chalcone synthase 1 OS=Ruta graveolens GN=CHS1 PE=2 SV=1)

HSP 1 Score: 342.428 bits (877), Expect = 4.544e-104
Identity = 167/180 (92.78%), Postives = 173/180 (96.11%), Query Frame = 2
Query:   59 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 598
            TV+ IR AQRADGPA VLAIGTATPA+ V QADYPDYYFRITKSEHMTELKEKFKRMCDKSMI+KRYM+LTE+ILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPG DYQLTKL+GLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR
Sbjct:    5 TVEAIRKAQRADGPAAVLAIGTATPANYVTQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIRKRYMHLTEDILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGCDYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 184          

HSP 2 Score: 57.3806 bits (137), Expect = 4.544e-104
Identity = 27/28 (96.43%), Postives = 28/28 (100.00%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDSL 678
            +GARVLVVCSEITAVTFRGPADTHLDSL
Sbjct:  184 RGARVLVVCSEITAVTFRGPADTHLDSL 211          
BLAST of FC920668 vs. ExPASy Swiss-Prot
Match: CHSY_BETVE (Chalcone synthase OS=Betula verrucosa GN=CHS PE=2 SV=2)

HSP 1 Score: 340.887 bits (873), Expect = 3.815e-103
Identity = 165/182 (90.66%), Postives = 174/182 (95.60%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 598
            MA+V+EIR AQRA GPATVLAIGTATP++ + QADYPDYYFRITKS+HMTELKEKFKRMCDKSMIKKRYMYL EEIL ENPNMCAYMAPSLDARQ IVVVEVPKLGKEAATKAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENN+
Sbjct:    1 MASVEEIRKAQRAHGPATVLAIGTATPSNCITQADYPDYYFRITKSDHMTELKEKFKRMCDKSMIKKRYMYLNEEILNENPNMCAYMAPSLDARQTIVVVEVPKLGKEAATKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 55.8398 bits (133), Expect = 3.815e-103
Identity = 26/28 (92.86%), Postives = 27/28 (96.43%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDSL 678
            +GARVLVVCSEITAVTFRGP DTHLDSL
Sbjct:  182 KGARVLVVCSEITAVTFRGPTDTHLDSL 209          
BLAST of FC920668 vs. ExPASy Swiss-Prot
Match: CHS3_SOYBN (Chalcone synthase 3 OS=Glycine max GN=CHS3 PE=3 SV=1)

HSP 1 Score: 338.961 bits (868), Expect = 1.442e-102
Identity = 163/182 (89.56%), Postives = 176/182 (96.70%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 598
            M +V+EIRNAQRA+GPATV+AIGTATP + V+Q+ YPDYYFRIT SEHMTELKEKFKRMCDKSMIKKRYMYL EEILKENP++CAYMAPSLDARQD+VVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRPSVKR+MMYQQGCFAGGTVLRLAKDLAENN+
Sbjct:    1 MVSVEEIRNAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHMTELKEKFKRMCDKSMIKKRYMYLNEEILKENPSVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 55.8398 bits (133), Expect = 1.442e-102
Identity = 26/28 (92.86%), Postives = 27/28 (96.43%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDSL 678
            +GARVLVVCSEITAVTFRGP DTHLDSL
Sbjct:  182 KGARVLVVCSEITAVTFRGPTDTHLDSL 209          
BLAST of FC920668 vs. ExPASy Swiss-Prot
Match: CHS1_SOYBN (Chalcone synthase 1 OS=Glycine max GN=CHS1 PE=3 SV=1)

HSP 1 Score: 336.65 bits (862), Expect = 7.113e-102
Identity = 162/182 (89.01%), Postives = 175/182 (96.15%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 598
            M +V+EIR AQRA+GPATV+AIGTATP + V+Q+ YPDYYFRIT SEHMTELKEKFKRMCDKSMIKKRYMYL EEILKENP++CAYMAPSLDARQD+VVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRPSVKR+MMYQQGCFAGGTVLRLAKDLAENN+
Sbjct:    1 MVSVEEIRKAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHMTELKEKFKRMCDKSMIKKRYMYLNEEILKENPSVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 55.8398 bits (133), Expect = 7.113e-102
Identity = 26/28 (92.86%), Postives = 27/28 (96.43%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDSL 678
            +GARVLVVCSEITAVTFRGP DTHLDSL
Sbjct:  182 KGARVLVVCSEITAVTFRGPTDTHLDSL 209          
BLAST of FC920668 vs. ExPASy Swiss-Prot
Match: CHS5_SOYBN (Chalcone synthase 5 OS=Glycine max GN=CHS5 PE=3 SV=1)

HSP 1 Score: 335.495 bits (859), Expect = 1.580e-101
Identity = 161/182 (88.46%), Postives = 175/182 (96.15%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 598
            M +V+EIR AQRA+GPATV+AIGTATP + V+Q+ YPDYYFRIT SEHMTELKEKFKRMCDKSMIKKRYMYL EEILKENP++CAYMAPSLDARQD+VV+EVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRPSVKR+MMYQQGCFAGGTVLRLAKDLAENN+
Sbjct:    1 MVSVEEIRQAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHMTELKEKFKRMCDKSMIKKRYMYLNEEILKENPSVCAYMAPSLDARQDMVVMEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 55.8398 bits (133), Expect = 1.580e-101
Identity = 26/28 (92.86%), Postives = 27/28 (96.43%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDSL 678
            +GARVLVVCSEITAVTFRGP DTHLDSL
Sbjct:  182 KGARVLVVCSEITAVTFRGPTDTHLDSL 209          
BLAST of FC920668 vs. ExPASy Swiss-Prot
Match: CHS2_SOYBN (Chalcone synthase 2 OS=Glycine max GN=CHS2 PE=3 SV=1)

HSP 1 Score: 335.495 bits (859), Expect = 1.580e-101
Identity = 161/182 (88.46%), Postives = 175/182 (96.15%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 598
            M +V+EIR AQRA+GPATV+AIGTATP + V+Q+ YPDYYFRIT SEHMTELKEKFKRMCDKSMIKKRYMYL EEILKENP++CAYMAPSLDARQD+VV+EVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKL+GLRPSVKR+MMYQQGCFAGGTVLRLAKDLAENN+
Sbjct:    1 MVSVEEIRKAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHMTELKEKFKRMCDKSMIKKRYMYLNEEILKENPSVCAYMAPSLDARQDMVVMEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLLGLRPSVKRYMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 55.8398 bits (133), Expect = 1.580e-101
Identity = 26/28 (92.86%), Postives = 27/28 (96.43%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDSL 678
            +GARVLVVCSEITAVTFRGP DTHLDSL
Sbjct:  182 KGARVLVVCSEITAVTFRGPTDTHLDSL 209          
BLAST of FC920668 vs. ExPASy Swiss-Prot
Match: CHS2_CAMSI (Chalcone synthase 2 OS=Camellia sinensis GN=CHS2 PE=2 SV=1)

HSP 1 Score: 336.265 bits (861), Expect = 2.689e-101
Identity = 161/182 (88.46%), Postives = 174/182 (95.60%), Query Frame = 2
Query:   53 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNR 598
            M TV+E+R AQRA+GPATV+AIGTATP + V+Q+ YPDYYFRIT SEH TELKEKF+RMCDKSMIKKRYMYLTEEILKENPN+CAYMAPSLDARQD+VVVEVPKLGKEAATKAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENN+
Sbjct:    1 MVTVEEVRRAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMIKKRYMYLTEEILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNK 182          

HSP 2 Score: 54.299 bits (129), Expect = 2.689e-101
Identity = 25/28 (89.29%), Postives = 27/28 (96.43%), Query Frame = 1
Query:  595 QGARVLVVCSEITAVTFRGPADTHLDSL 678
            +GARVLVVCSEITAVTFRGP+D HLDSL
Sbjct:  182 KGARVLVVCSEITAVTFRGPSDAHLDSL 209          
The following BLAST results are available for this feature:
BLAST of FC920668 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 145
Match NameE-valueIdentityDescription
CHS2_CITSI8.266e-11299.45Chalcone synthase 2 OS=Citrus sinensis GN=CHS2 PE=... [more]
CHS2_RUTGR2.437e-10593.89Chalcone synthase 2 OS=Ruta graveolens GN=CHS2 PE=... [more]
CHS3_RUTGR7.061e-10593.89Chalcone synthase 3 OS=Ruta graveolens GN=CHS3 PE=... [more]
CHS1_RUTGR4.544e-10492.78Chalcone synthase 1 OS=Ruta graveolens GN=CHS1 PE=... [more]
CHSY_BETVE3.815e-10390.66Chalcone synthase OS=Betula verrucosa GN=CHS PE=2 ... [more]
CHS3_SOYBN1.442e-10289.56Chalcone synthase 3 OS=Glycine max GN=CHS3 PE=3 SV... [more]
CHS1_SOYBN7.113e-10289.01Chalcone synthase 1 OS=Glycine max GN=CHS1 PE=3 SV... [more]
CHS5_SOYBN1.580e-10188.46Chalcone synthase 5 OS=Glycine max GN=CHS5 PE=3 SV... [more]
CHS2_SOYBN1.580e-10188.46Chalcone synthase 2 OS=Glycine max GN=CHS2 PE=3 SV... [more]
CHS2_CAMSI2.689e-10188.46Chalcone synthase 2 OS=Camellia sinensis GN=CHS2 P... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32011E03EF RVDevelop1 Citrus clementina cDNA clone C32011E03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920668 ID=FC920668|Name=FC920668|organism=Citrus clementina|type=EST|length=688bp
GGAACTCACCAAGCACGAGCCACCAACATATTCATTAAGGGTTCAACTTG
AAATGGCAACCGTTCAAGAGATCAGAAACGCTCAGCGTGCCGACGGCCCG
GCCACCGTCCTCGCCATCGGTACGGCCACGCCTGCCCACAGTGTCAACCA
GGCTGATTATCCCGACTATTACTTCAGGATCACAAAGAGCGAGCATATGA
CGGAGCTTAAAGAGAAGTTCAAGCGCATGTGTGACAAGTCGATGATTAAG
AAGCGTTACATGTACTTAACGGAAGAGATTTTGAAGGAAAACCCCAACAT
GTGCGCTTACATGGCTCCATCACTCGACGCACGTCAAGACATTGTGGTGG
TCGAAGTGCCGAAGCTCGGGAAAGAAGCTGCTACAAAGGCCATCAAAGAA
TGGGGCCAGCCCAAGTCTAAGATCACCCACCTCATCTTCTGCACCACCTC
CGGCGTCGACATGCCCGGCGCCGACTACCAGCTCACCAAACTGATCGGCC
TGCGCCCCTCCGTCAAGCGCTTCATGATGTACCAACAAGGATGTTTCGCC
GGCGGCACTGTTCTTCGCCTCGCTAAAGACTTGGCTGAGAACAACAGGGC
GCTCGCGTTCTTGTTGTCTGTTCGGAGATCACGGCAGTCACTTTCCGCGG
CCCTGCCGATACTCATCTTGATTCTCTTTGTGAGCCAG
back to top