FC920671

Overview
NameFC920671
Unique NameFC920671
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length719
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC920671_ssr520 microsatellite FC920671_ssr520:520..529. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig9378 contig Ccv1_Contig9378:13..731. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920671 vs. ExPASy Swiss-Prot
Match: KIN17_HUMAN (DNA/RNA-binding protein KIN17 OS=Homo sapiens GN=KIN PE=1 SV=2)

HSP 1 Score: 237.269 bits (604), Expect = 6.393e-62
Identity = 106/165 (64.24%), Postives = 131/165 (79.39%), Query Frame = 2
Query:   14 MGKNEFLTPKAIANRIKAKGLQKLRWYCQMCQKQCRDENGFKCHCMSESHQRQMQIFGQNPDRIVEGYSEEFEAGFLELMRRSHRFSRIAATVVYNEYIHDRHHVHMNSTRWATLTEFVKYLGRTGKCKVEETPKGWFITYIDRDSETLFKEKMKNKRIKLDMVD 508
            MGK++FLTPKAIANRIK+KGLQKLRWYCQMCQKQCRDENGFKCHCMSESHQRQ+ +  +NP + ++ +SEEF   FLEL+RR     R+   +VYNEYI  R H+HMN+T+W TLT+F K+LGR G CKV+ETPKGW+I YIDRD ET+ ++    K+ K D+ D
Sbjct:    1 MGKSDFLTPKAIANRIKSKGLQKLRWYCQMCQKQCRDENGFKCHCMSESHQRQLLLASENPQQFMDYFSEEFRNDFLELLRRRFGTKRVHNNIVYNEYISHREHIHMNATQWETLTDFTKWLGREGLCKVDETPKGWYIQYIDRDPETIRRQLELEKKKKQDLDD 165          
BLAST of FC920671 vs. ExPASy Swiss-Prot
Match: KIN17_MOUSE (DNA/RNA-binding protein KIN17 OS=Mus musculus GN=Kin PE=2 SV=1)

HSP 1 Score: 235.728 bits (600), Expect = 1.860e-61
Identity = 105/165 (63.64%), Postives = 131/165 (79.39%), Query Frame = 2
Query:   14 MGKNEFLTPKAIANRIKAKGLQKLRWYCQMCQKQCRDENGFKCHCMSESHQRQMQIFGQNPDRIVEGYSEEFEAGFLELMRRSHRFSRIAATVVYNEYIHDRHHVHMNSTRWATLTEFVKYLGRTGKCKVEETPKGWFITYIDRDSETLFKEKMKNKRIKLDMVD 508
            MGK++FL+PKAIANRIK+KGLQKLRWYCQMCQKQCRDENGFKCHCMSESHQRQ+ +  +NP + ++ +SEEF   FLEL+RR     R+   +VYNEYI  R H+HMN+T+W TLT+F K+LGR G CKV+ETPKGW+I YIDRD ET+ ++    K+ K D+ D
Sbjct:    1 MGKSDFLSPKAIANRIKSKGLQKLRWYCQMCQKQCRDENGFKCHCMSESHQRQLLLASENPQQFMDYFSEEFRNDFLELLRRRFGTKRVHNNIVYNEYISHREHIHMNATQWETLTDFTKWLGREGLCKVDETPKGWYIQYIDRDPETIRRQLELEKKKKQDLDD 165          
BLAST of FC920671 vs. ExPASy Swiss-Prot
Match: KIN17_DICDI (KIN17-like protein OS=Dictyostelium discoideum GN=DDB_G0269816 PE=3 SV=1)

HSP 1 Score: 224.557 bits (571), Expect = 4.288e-58
Identity = 101/163 (61.96%), Postives = 124/163 (76.07%), Query Frame = 2
Query:   14 MGKNEFLTPKAIANRIKAKGLQKLRWYCQMCQKQCRDENGFKCHCMSESHQRQMQIFGQNPDRIVEGYSEEFEAGFLELMRRSHRFSRIAATVVYNEYIHDRHHVHMNSTRWATLTEFVKYLGRTGKCKVEETPKGWFITYIDRDSETLFKEKMKNKRIKLDM 502
            MGK + LTPK IAN+IKAKGLQ+LRWYCQ+C+KQCRDENGFKCH  SESH RQM++F      IV  YS+EFE  FL +M R    SR+ A  VY EYI DRHH+HMN+T W +LTEFVKYLG+T KC+VEETPKGWFI YI+RD E + ++  + K+ K ++
Sbjct:    1 MGKGDALTPKQIANKIKAKGLQRLRWYCQLCEKQCRDENGFKCHISSESHMRQMEVFSNKSSFIVSQYSKEFEEDFLRIMSRQFINSRVPANQVYAEYIKDRHHIHMNATEWTSLTEFVKYLGKTSKCEVEETPKGWFIRYINRDPEYVMRKVSEEKKEKAEL 163          
BLAST of FC920671 vs. ExPASy Swiss-Prot
Match: KIN17_SCHPO (KIN17-like protein OS=Schizosaccharomyces pombe GN=SPBC365.09c PE=2 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 9.909e-47
Identity = 83/165 (50.30%), Postives = 113/165 (68.48%), Query Frame = 2
Query:   14 MGKNEFLTPKAIANRIKAKGLQKLRWYCQMCQKQCRDENGFKCHCMSESHQRQMQIFGQNPDRIVEGYSEEFEAGFLELMRRSHRFSRIAATVVYNEYIHDRHHVHMNSTRWATLTEFVKYLGRTGKCKVEETPKGWFITYIDRDSETLFKEKMKNKRIKLDMVD 508
            MG+ E  TPKAI+N +K+KGLQ+LRWYC  CQKQ RDENGFKCH  SE H RQM +   NP + ++ +S +F   F+ L+R +H   +I     Y EYI D++HVHMN+TRW TL+EF K+LGR G C+VEE  KG+FI+YID++   + + +   KR + +  D
Sbjct:    1 MGRAEAGTPKAISNALKSKGLQRLRWYCSACQKQMRDENGFKCHTQSEGHIRQMNVIAMNPGKRIQDFSNQFLRDFISLLRTAHGEKKIHFNQFYQEYIRDKNHVHMNATRWHTLSEFCKFLGRQGMCRVEENEKGFFISYIDKNPANILRNEANKKRERQEKSD 165          
BLAST of FC920671 vs. ExPASy Swiss-Prot
Match: RTS2_YEAST (Zinc finger protein RTS2 OS=Saccharomyces cerevisiae GN=RTS2 PE=1 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 3.314e-26
Identity = 57/114 (50.00%), Postives = 80/114 (70.18%), Query Frame = 2
Query:   68 KGLQKLRWYCQMCQKQCRDENGFKCHCMSESHQRQM-QIFGQNPDRIVEGYSEEFEAGFLELMRRSHRFSRIAATVVYNEYIHDRHHVHMNSTRWATLTEFVKYLGRTGKCKVE 406
            +GLQK R+YCQ+CQ+QC+D NGF+ H  S SH R++ Q+  ++  R    Y+ +FE GFL+L+++ H    I A  VYNEY+ DR HVHMN+T   +LT+FV+YLGR GK  V+
Sbjct:   17 RGLQKTRYYCQICQRQCKDANGFQSHNKSPSHLRKISQVTAEDARR----YNIQFEKGFLQLLKQRHGEKWIDANKVYNEYVQDRDHVHMNATMHRSLTQFVRYLGRAGKVDVD 126          
The following BLAST results are available for this feature:
BLAST of FC920671 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
KIN17_HUMAN6.393e-6264.24DNA/RNA-binding protein KIN17 OS=Homo sapiens GN=K... [more]
KIN17_MOUSE1.860e-6163.64DNA/RNA-binding protein KIN17 OS=Mus musculus GN=K... [more]
KIN17_DICDI4.288e-5861.96KIN17-like protein OS=Dictyostelium discoideum GN=... [more]
KIN17_SCHPO9.909e-4750.30KIN17-like protein OS=Schizosaccharomyces pombe GN... [more]
RTS2_YEAST3.314e-2650.00Zinc finger protein RTS2 OS=Saccharomyces cerevisi... [more]
back to top
Properties
Property NameValue
Genbank descriptionC32011E07EF RVDevelop1 Citrus clementina cDNA clone C32011E07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920671 ID=FC920671|Name=FC920671|organism=Citrus clementina|type=EST|length=719bp
GGTTGAATGAGAGATGGGAAAGAACGAGTTCTTAACACCAAAGGCAATTG
CTAACAGAATCAAAGCGAAAGGGTTACAGAAGCTACGATGGTACTGCCAG
ATGTGTCAGAAGCAATGCAGAGACGAGAATGGCTTCAAATGCCACTGCAT
GAGCGAAAGCCACCAGCGTCAGATGCAAATCTTCGGTCAAAACCCCGACC
GAATCGTCGAGGGTTACTCCGAAGAATTCGAAGCCGGCTTCCTCGAACTC
ATGAGGCGCAGCCACCGCTTCAGCCGCATCGCCGCCACCGTCGTTTACAA
CGAGTACATCCACGACCGACACCACGTCCACATGAATTCCACCAGGTGGG
CTACCCTGACCGAGTTTGTCAAGTACTTGGGCCGGACCGGTAAGTGCAAA
GTTGAGGAGACTCCAAAGGGTTGGTTTATTACTTATATTGATAGAGATTC
AGAGACCCTTTTCAAGGAAAAGATGAAAAACAAGAGAATTAAGTTGGATA
TGGTTGACGAAGAGAGGCAAGAGAGAGAGATTCAAAAGCAAATTGAGATT
GCTGCTTCTTCTTCCGTTTCTTCGACCAATCCCCTTTCTAATTCTGAGGA
TAACACCACCAGGGAATTGAATTTGGAGGCTGCGGCTGCTGTAGGTAAGG
TTGGCTTTGCACTTGGGTCATCATACAAAGATATGNTACCAGTATGGTAG
TGGTAATATGGTAGTAGTA
back to top