FC920695

Overview
NameFC920695
Unique NameFC920695
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length703
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC920695_ssr8 microsatellite FC920695_ssr8:8..22. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of FC920695 vs. ExPASy Swiss-Prot
Match: SAT3_ARATH (Serine acetyltransferase 3, mitochondrial OS=Arabidopsis thaliana GN=SAT3 PE=1 SV=3)

HSP 1 Score: 191.815 bits (486), Expect = 2.969e-48
Identity = 104/211 (49.29%), Postives = 138/211 (65.40%), Query Frame = 3
Query:   93 MATCIDTS-----QIS-QDPSRSQNDDHAYRYAKHCRPSFSDRVSCVPFNRNQEQAIHTRSNIXXXXXXXXX--LWLKMQDEARSDVEEEPVLSSYYFASILSHKSLEXXXXXXXXXXXXXXXXQSGTLFELFMGVIVEDQEIIKAVKADLIAVKERDPACISYVHCLLNFKGFLACQAHRIAHRLWLQGKKVLALLIQNRVSEGFSVDIH 701
            MA CIDT      QIS +D S+  +D+  +RY  + R  + DR S   FN  Q + +HTR  +           +W K+++EA+SD+ +EP++S+YY ASI+S +SLE                 S TLF+LF GV+  + +I+++VK DL+AVKERDPACISYVHC L+FKGFLACQAHRIAH LW Q +K+LALLIQNRVSE F+VD H
Sbjct:   56 MAACIDTCRTGKPQISPRDSSKHHDDESGFRYMNYFR--YPDRSS---FNGTQTKTLHTRPLLEDLDRDAEVDDVWAKIREEAKSDIAKEPIVSAYYHASIVSQRSLEAALANTLSVKLSNLNLPSNTLFDLFSGVLQGNPDIVESVKLDLLAVKERDPACISYVHCFLHFKGFLACQAHRIAHELWTQDRKILALLIQNRVSEAFAVDFH 261          
BLAST of FC920695 vs. ExPASy Swiss-Prot
Match: SAT1_ARATH (Serine acetyltransferase 1 OS=Arabidopsis thaliana GN=SAT1 PE=1 SV=2)

HSP 1 Score: 187.578 bits (475), Expect = 5.600e-47
Identity = 106/204 (51.96%), Postives = 130/204 (63.73%), Query Frame = 3
Query:   93 MATCIDTSQISQDPSRSQNDDHAYRYAKHC-RPSFSDRVSCVPFNRNQEQAIHTRSNIXXXXXXXXXLWLKMQDEARSDVEEEPVLSSYYFASILSHKSLEXXXXXXXXXXXXXXXXQSGTLFELFMGVIVEDQEIIKAVKADLIAVKERDPACISYVHCLLNFKGFLACQAHRIAHRLWLQGKKVLALLIQNRVSEGFSVDIH 701
            MATCIDT +       +Q+DD  +   K+  RP FS        NR      HT+            +W+KM +EA+SDV++EP+LS+YY+ASI SH+SLE                 S TLFELF+ V+ E  EII++ K DLIAVKERDPACISYVHC L FKGFLACQAHRIAH LW Q +K++ALLIQNRVSE F+VDIH
Sbjct:    1 MATCIDTCRTGN----TQDDDSRFCCIKNFFRPGFS-------VNRKIH---HTQIE------DDDDVWIKMLEEAKSDVKQEPILSNYYYASITSHRSLESALAHILSVKLSNLNLPSNTLFELFISVLEESPEIIESTKQDLIAVKERDPACISYVHCFLGFKGFLACQAHRIAHTLWKQNRKIVALLIQNRVSESFAVDIH 184          
BLAST of FC920695 vs. ExPASy Swiss-Prot
Match: SAT5_ARATH (Serine acetyltransferase 5 OS=Arabidopsis thaliana GN=SAT5 PE=1 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 4.308e-31
Identity = 65/137 (47.45%), Postives = 88/137 (64.23%), Query Frame = 3
Query:  291 LWLKMQDEARSDVEEEPVLSSYYFASILSHKSLEXXXXXXXXXXXXXXXXQSGTLFELFMGVIVEDQEIIKAVKADLIAVKERDPACISYVHCLLNFKGFLACQAHRIAHRLWLQGKKVLALLIQNRVSEGFSVDIH 701
            LW +++ EAR D E EP L+SY +++ILSH SLE                 S  L++LF+     D  +  A  ADL A + RDPACIS+ HCLLN+KGFLA QAHR++H+LW Q +K LAL + +R+S+ F+VDIH
Sbjct:   45 LWTQIKAEARRDAEAEPALASYLYSTILSHSSLERSISFHLGNKLCSSTLLSTLLYDLFLNTFSSDPSLRNATVADLRAARVRDPACISFSHCLLNYKGFLAIQAHRVSHKLWTQSRKPLALALHSRISDVFAVDIH 181          
BLAST of FC920695 vs. ExPASy Swiss-Prot
Match: SAT4_ARATH (Serine acetyltransferase 4 OS=Arabidopsis thaliana GN=SAT4 PE=1 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 1.810e-29
Identity = 62/137 (45.26%), Postives = 92/137 (67.15%), Query Frame = 3
Query:  291 LWLKMQDEARSDVEEEPVLSSYYFASILSHKSLEXXXXXXXXXXXXXXXXQSGTLFELFMGVIVEDQEIIKAVKADLIAVKERDPACISYVHCLLNFKGFLACQAHRIAHRLWLQGKKVLALLIQNRVSEGFSVDIH 701
            +W  +++EA+ + EEEPVLSS+ +ASILSH  LE                 +  L ++F  V+V D+ I  +++ D+ A K+RDPAC+SY   +L+ KG+LA QA+R+AH+LW QG+K+LAL +Q+RVSE F +DIH
Sbjct:   73 IWDSIREEAKLEAEEEPVLSSFLYASILSHDCLEQALSFVLANRLQNPTLLATQLMDIFCNVMVHDRGIQSSIRLDVQAFKDRDPACLSYSSAILHLKGYLALQAYRVAHKLWKQGRKLLALALQSRVSEVFGIDIH 209          
BLAST of FC920695 vs. ExPASy Swiss-Prot
Match: SAT1_ORYSJ (Probable serine acetyltransferase 1 OS=Oryza sativa subsp. japonica GN=SAT1 PE=2 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 1.532e-28
Identity = 60/137 (43.80%), Postives = 88/137 (64.23%), Query Frame = 3
Query:  291 LWLKMQDEARSDVEEEPVLSSYYFASILSHKSLEXXXXXXXXXXXXXXXXQSGTLFELFMGVIVEDQEIIKAVKADLIAVKERDPACISYVHCLLNFKGFLACQAHRIAHRLWLQGKKVLALLIQNRVSEGFSVDIH 701
            +W +++ EAR D + EP L+S+ +A++LSH SL+                 S  L++LF+  +     +  AV ADL+A + RDPAC+ + HCLLN+KGFLA QA R+AH LW Q ++ LAL +Q+RV+E F+VDIH
Sbjct:   41 VWSQIKAEARRDADAEPALASFLYATVLSHPSLDRSLAFHLANKLCSSTLLSTLLYDLFVASLAAHPTLRAAVVADLLAARSRDPACVGFSHCLLNYKGFLAIQAQRVAHVLWAQDRRALALALQSRVAEVFAVDIH 177          
BLAST of FC920695 vs. ExPASy Swiss-Prot
Match: SAT5_ORYSJ (Probable serine acetyltransferase 5 OS=Oryza sativa subsp. japonica GN=SAT5 PE=2 SV=2)

HSP 1 Score: 122.865 bits (307), Expect = 1.694e-27
Identity = 59/137 (43.07%), Postives = 86/137 (62.77%), Query Frame = 3
Query:  291 LWLKMQDEARSDVEEEPVLSSYYFASILSHKSLEXXXXXXXXXXXXXXXXQSGTLFELFMGVIVEDQEIIKAVKADLIAVKERDPACISYVHCLLNFKGFLACQAHRIAHRLWLQGKKVLALLIQNRVSEGFSVDIH 701
            +W +++ EAR D + EP L+S+ +A++LSH SL                  S  L++LF+        +  AV ADL+A + RDPAC+ +  CLLNFKGFLA QAHR++H LW Q ++ LAL +Q+RV++ F+VDIH
Sbjct:   73 VWSQIKAEARRDADAEPALASFLYATVLSHPSLPRSISFHLANKLCSSTLLSTLLYDLFLASFTAHPSLRAAVVADLLAARSRDPACVGFSQCLLNFKGFLAIQAHRVSHVLWAQQRRPLALALQSRVADVFAVDIH 209          
BLAST of FC920695 vs. ExPASy Swiss-Prot
Match: SAT2_ARATH (Serine acetyltransferase 2 OS=Arabidopsis thaliana GN=SAT2 PE=1 SV=2)

HSP 1 Score: 121.709 bits (304), Expect = 3.774e-27
Identity = 56/137 (40.88%), Postives = 91/137 (66.42%), Query Frame = 3
Query:  291 LWLKMQDEARSDVEEEPVLSSYYFASILSHKSLEXXXXXXXXXXXXXXXXQSGTLFELFMGVIVEDQEIIKAVKADLIAVKERDPACISYVHCLLNFKGFLACQAHRIAHRLWLQGKKVLALLIQNRVSEGFSVDIH 701
            +W  +++EA+ + E+EP+LSS+ +A IL+H  LE                 +  L ++F GV++ D+ I  +++ DL A K+RDPAC+SY   +L+ KG+ A QA+R+AH+LW +G+K+LAL +Q+R+SE F +DIH
Sbjct:   36 IWDAIREEAKLEAEKEPILSSFLYAGILAHDCLEQALGFVLANRLQNPTLLATQLLDIFYGVMMHDKGIQSSIRHDLQAFKDRDPACLSYSSAILHLKGYHALQAYRVAHKLWNEGRKLLALALQSRISEVFGIDIH 172          
BLAST of FC920695 vs. ExPASy Swiss-Prot
Match: SAT2_ORYSJ (Probable serine acetyltransferase 2 OS=Oryza sativa subsp. japonica GN=SAT2 PE=2 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 7.117e-26
Identity = 57/137 (41.61%), Postives = 89/137 (64.96%), Query Frame = 3
Query:  291 LWLKMQDEARSDVEEEPVLSSYYFASILSHKSLEXXXXXXXXXXXXXXXXQSGTLFELFMGVIVEDQEIIKAVKADLIAVKERDPACISYVHCLLNFKGFLACQAHRIAHRLWLQGKKVLALLIQNRVSEGFSVDIH 701
            +W  ++ EA+S+ E+EP+LSS+ +AS+LSH  LE                 +  L ++F  V++ +++I ++++ D  A K+RDPAC  Y   LL  KG+ + Q++RIAH LW QG+KVLAL +Q+R+SE F+VDIH
Sbjct:   80 IWEAVKSEAKSEAEKEPILSSFLYASVLSHDCLERALSFVLANRLEDPTLLATQLIDIFNDVMMNNKDIRRSIRLDAQAFKDRDPACAQYSWALLYLKGYHSVQSYRIAHVLWNQGRKVLALALQSRISEVFAVDIH 216          
BLAST of FC920695 vs. ExPASy Swiss-Prot
Match: SAT4_ORYSJ (Probable serine acetyltransferase 4 OS=Oryza sativa subsp. japonica GN=SAT4 PE=2 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 5.639e-23
Identity = 56/138 (40.58%), Postives = 77/138 (55.80%), Query Frame = 3
Query:  291 LWLKMQDEARSDVEEEPVLSSYYFASILSHKSLEXXXXXXXXXXXXXXXX-QSGTLFELFMGVIVEDQEIIKAVKADLIAVKERDPACISYVHCLLNFKGFLACQAHRIAHRLWLQGKKVLALLIQNRVSEGFSVDIH 701
            +W  ++ EA+ D ++EP+L  +Y   +LS  SLE                     L +L  G +    E  +A +ADL+A ++RDPAC   VHC L +KGFLA QAHR AH LW   ++  ALL+Q+R SE F VDIH
Sbjct:   54 VWDVLRAEAQDDADDEPLLRKFYHDLVLSRPSLESALASLLAAKLCIPGALPQDQLRDLLAGALAAHPEAGRAARADLVAARDRDPACAKMVHCFLYYKGFLALQAHRAAHALWSDNRRAPALLLQSRASEVFGVDIH 191          
BLAST of FC920695 vs. ExPASy Swiss-Prot
Match: SAT3_ORYSJ (Probable serine acetyltransferase 3 OS=Oryza sativa subsp. japonica GN=SAT3 PE=2 SV=2)

HSP 1 Score: 105.531 bits (262), Expect = 2.799e-22
Identity = 55/138 (39.86%), Postives = 76/138 (55.07%), Query Frame = 3
Query:  291 LWLKMQDEARSDVEEEPVLSSYYFASILSHKSLEXXXXXXXXXXXXXXXX-QSGTLFELFMGVIVEDQEIIKAVKADLIAVKERDPACISYVHCLLNFKGFLACQAHRIAHRLWLQGKKVLALLIQNRVSEGFSVDIH 701
            +W  ++ EA+ D ++EP+L  +Y   +LS  SLE                     L +L  G +    E  +A +ADL A ++RDPAC   VHC L ++GFLA QAHR AH LW   ++  ALL+Q+R SE F VDIH
Sbjct:   48 VWDALRAEAQDDADDEPLLRKFYHDLVLSRPSLESALASLLAAKLCIPGALPQDQLRDLLAGALAAHPEAGRAARADLAAARDRDPACAKMVHCFLYYRGFLALQAHRAAHALWSDNRRAPALLLQSRASEVFGVDIH 185          
The following BLAST results are available for this feature:
BLAST of FC920695 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 19
Match NameE-valueIdentityDescription
SAT3_ARATH2.969e-4849.29Serine acetyltransferase 3, mitochondrial OS=Arabi... [more]
SAT1_ARATH5.600e-4751.96Serine acetyltransferase 1 OS=Arabidopsis thaliana... [more]
SAT5_ARATH4.308e-3147.45Serine acetyltransferase 5 OS=Arabidopsis thaliana... [more]
SAT4_ARATH1.810e-2945.26Serine acetyltransferase 4 OS=Arabidopsis thaliana... [more]
SAT1_ORYSJ1.532e-2843.80Probable serine acetyltransferase 1 OS=Oryza sativ... [more]
SAT5_ORYSJ1.694e-2743.07Probable serine acetyltransferase 5 OS=Oryza sativ... [more]
SAT2_ARATH3.774e-2740.88Serine acetyltransferase 2 OS=Arabidopsis thaliana... [more]
SAT2_ORYSJ7.117e-2641.61Probable serine acetyltransferase 2 OS=Oryza sativ... [more]
SAT4_ORYSJ5.639e-2340.58Probable serine acetyltransferase 4 OS=Oryza sativ... [more]
SAT3_ORYSJ2.799e-2239.86Probable serine acetyltransferase 3 OS=Oryza sativ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32011H03EF RVDevelop1 Citrus clementina cDNA clone C32011H03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920695 ID=FC920695|Name=FC920695|organism=Citrus clementina|type=EST|length=703bp
GAGAACATCTCCTCTCCTCTCCAGCTTCTTCACGAACATCACCAATTTTC
TCTCTATCCAAACACCACCGCGAAAAAACTTCCACAGCCGTTATGGCTAC
TTGTATTGATACTTCTCAAATTTCCCAGGATCCAAGCAGGTCTCAAAATG
ATGATCATGCATACAGGTACGCAAAACACTGCCGGCCCAGTTTTTCCGAT
CGTGTTTCTTGCGTGCCCTTTAATAGAAACCAGGAACAAGCCATACACAC
GCGTTCAAATATTGATGACGGCGATGATGCTGATGTTGATCTATGGCTCA
AAATGCAAGACGAAGCAAGATCGGACGTTGAGGAAGAACCTGTCCTGTCA
AGCTACTATTTCGCTTCAATCTTGTCGCATAAGTCCCTTGAAAGCGCTCT
GGCAAAACATCTTTCAATTAAATTAAGCAGTTTGAGCCTTCAAAGCGGTA
CGTTGTTTGAACTTTTCATGGGGGTGATTGTAGAGGATCAAGAAATTATC
AAAGCCGTGAAGGCTGATTTGATAGCCGTTAAAGAAAGAGACCCTGCGTG
CATAAGTTATGTGCATTGTCTTTTAAATTTCAAAGGGTTTTTAGCTTGCC
AGGCACATAGGATAGCACATCGGCTGTGGTTACAAGGGAAGAAAGTTTTG
GCTCTGTTAATACAAAACAGGGTGTCCGAAGGTTTCTCCGTTGATATTCA
TCC
back to top