FC920697

Overview
NameFC920697
Unique NameFC920697
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length741
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15382 contig Ccv1_Contig15382:10..750. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXD2_ARATH (Annexin D2 OS=Arabidopsis thaliana GN=ANN2 PE=2 SV=1)

HSP 1 Score: 329.717 bits (844), Expect = 9.995e-90
Identity = 159/223 (71.30%), Postives = 188/223 (84.30%), Query Frame = 2
Query:   50 MATLKVPTQTPSAAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEELIRILTTRSKAQINATLNHYNDAFGNAXHKDLKAD 718
            MA+LKVP+  P   +DAEQLHKAF GWGTNE LIIS+LAHRNAAQR LIR +Y  TY EDLLKALDKELSSDFER+V+LWTL P ERDAYLA E+TK  T +NWVL+EIACTR + +L   KQAY ARYKKS+EEDVA HTSGD RKLL+PLVSTFRY+G DVNMMLAR+EAKI+ +K+S+K Y+ ++ IRILTTRSKAQ+ ATLNHYN+ +GNA +K+LK +
Sbjct:    1 MASLKVPSNVPLPEDDAEQLHKAFSGWGTNEKLIISILAHRNAAQRSLIRSVYAATYNEDLLKALDKELSSDFERAVMLWTLDPPERDAYLAKESTKMFTKNNWVLVEIACTRPALELIKVKQAYQARYKKSIEEDVAQHTSGDLRKLLLPLVSTFRYEGDDVNMMLARSEAKILHEKVSEKSYSDDDFIRILTTRSKAQLGATLNHYNNEYGNAINKNLKEE 223          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXD7_ARATH (Annexin D7 OS=Arabidopsis thaliana GN=ANNAT7 PE=2 SV=1)

HSP 1 Score: 318.161 bits (814), Expect = 3.009e-86
Identity = 157/223 (70.40%), Postives = 182/223 (81.61%), Query Frame = 2
Query:   50 MATLKVPTQTPSAAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEELIRILTTRSKAQINATLNHYNDAFGNAXHKDLKAD 718
            MA+LKVP   P   EDAEQL+KAF+GWGTNE +IIS+LAHRNA QR  IR +Y   Y +DLLK LD+ELS DFER+V+LWT  PAERDAYLA E+TK  T +NWVL+EIACTRS+ +LF AKQAY ARYK SLEEDVAYHTSGD RKLLVPLVSTFRYDG +VNM LAR+EAKI+ +KI +K YA ++LIRILTTRSKAQI+ATLNHY + FG +  K LK D
Sbjct:    1 MASLKVPATVPLPEEDAEQLYKAFKGWGTNERMIISILAHRNATQRSFIRAVYAANYNKDLLKELDRELSGDFERAVMLWTFEPAERDAYLAKESTKMFTKNNWVLVEIACTRSALELFNAKQAYQARYKTSLEEDVAYHTSGDIRKLLVPLVSTFRYDGDEVNMTLARSEAKILHEKIKEKAYADDDLIRILTTRSKAQISATLNHYKNNFGTSMSKYLKED 223          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXD1_ARATH (Annexin D1 OS=Arabidopsis thaliana GN=ANN1 PE=1 SV=1)

HSP 1 Score: 307.76 bits (787), Expect = 4.067e-83
Identity = 152/221 (68.78%), Postives = 182/221 (82.35%), Query Frame = 2
Query:   50 MATLKVPTQTPSAAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEELIRILTTRSKAQINATLNHYNDAFGNAXHKDLK 712
            MATLKV    P+ ++DAEQL  AF+GWGTNE LIIS+LAHR+A QRK+IR+ Y+ETYGEDLLK LDKELS+DFER++LLWTL P ERDA LANEATKR TSSN VLME+ACTR+S  L  A+QAYHARYKKSLEEDVA+HT+GDFRKLLV LV+++RY+G +VNM LA+ EAK++ +KI DK Y  E++IRIL+TRSKAQINAT N Y D  G    K L+
Sbjct:    1 MATLKVSDSVPAPSDDAEQLRTAFEGWGTNEDLIISILAHRSAEQRKVIRQAYHETYGEDLLKTLDKELSNDFERAILLWTLEPGERDALLANEATKRWTSSNQVLMEVACTRTSTQLLHARQAYHARYKKSLEEDVAHHTTGDFRKLLVSLVTSYRYEGDEVNMTLAKQEAKLVHEKIKDKHYNDEDVIRILSTRSKAQINATFNRYQDDHGEEILKSLE 221          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXD6_ARATH (Annexin D6 OS=Arabidopsis thaliana GN=ANN6 PE=2 SV=1)

HSP 1 Score: 305.834 bits (782), Expect = 1.546e-82
Identity = 152/225 (67.56%), Postives = 177/225 (78.67%), Query Frame = 2
Query:   50 MATLKVPTQTPSAAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGG--DVNMMLARTEAKIIRDKISDKDYAHEELIRILTTRSKAQINATLNHYNDAFGNAXHKDLKAD 718
            MA+LK+P   P   ED+EQLHKAF+GWGTNE +IIS+LAHRNA QR  IR +Y   Y +DLLK LD ELS DFER V+LWTL P ERDAYLANE+TK  T + WVL+EIACTR S + F  KQAYH RYK SLEEDVAYHTSG+ RKLLVPLVSTFRYDG   +VN+ LAR+EAK +  KI++K Y  E+LIRILTTRSKAQINATLNH+ D FG++ +K LK D
Sbjct:    1 MASLKIPANIPLPEEDSEQLHKAFKGWGTNEGMIISILAHRNATQRSFIRAVYAANYNKDLLKELDGELSGDFERVVMLWTLDPTERDAYLANESTKLFTKNIWVLVEIACTRPSLEFFKTKQAYHVRYKTSLEEDVAYHTSGNIRKLLVPLVSTFRYDGNADEVNVKLARSEAKTLHKKITEKAYTDEDLIRILTTRSKAQINATLNHFKDKFGSSINKFLKED 225          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANX4_FRAAN (Annexin-like protein RJ4 OS=Fragaria ananassa PE=2 SV=2)

HSP 1 Score: 233.032 bits (593), Expect = 1.273e-60
Identity = 122/220 (55.45%), Postives = 152/220 (69.09%), Query Frame = 2
Query:   50 MATLKVPTQTPSAAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEELIRILTTRSKAQINATLNHYNDAFGNAXHKDL 709
            MATL  P     A EDAE L K+ +GWGTNE  IIS+L HRNA QRK IR  Y + Y EDLLK L+ ELS DFE++V  WTL PA+RDA LAN A K+ T    V++EI+C  S  +L A ++AY  RYK S+EED+A HT+GD RKLLV LV+ +RYDG ++N  LA +EA I+ D I DK + HEE+IRIL+TRSK Q+ AT N Y D  G +  K+L
Sbjct:    1 MATLVSPPNF-CAKEDAEALRKSVKGWGTNEKAIISILGHRNAGQRKEIRAAYEQLYQEDLLKPLESELSGDFEKAVYRWTLDPADRDAVLANVAIKKSTDVYNVIIEISCIHSPEELLAVRRAYQLRYKHSVEEDLAAHTTGDIRKLLVALVTAYRYDGHEINAKLANSEADILHDAIKDKAFNHEEIIRILSTRSKTQLMATFNKYRDDQGISISKNL 219          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXD3_ARATH (Annexin D3 OS=Arabidopsis thaliana GN=ANN3 PE=2 SV=2)

HSP 1 Score: 173.326 bits (438), Expect = 1.197e-42
Identity = 96/229 (41.92%), Postives = 134/229 (58.52%), Query Frame = 2
Query:   50 MATLKVPTQTPSAAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLAN-----EATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEELIRILTTRSKAQINATLNHYNDAFGNAXHKDLKADP 721
            MAT++VP + PS A+D+E L +A +GWGT+E  II VL  R+ +QR+ IRE + E YG+DL+  L  ELS DF ++V+ WT  PAERDA L N     E  K+   +  V++EI+CT S   L A ++AY + +  SLEE +A        KLLV L STFRYD    +  +A  EA ++R+ I  K   H+ ++ IL TRS  Q+  T   Y   +G    KD+   P
Sbjct:    1 MATIRVPNEVPSPAQDSETLKQAIRGWGTDEKAIIRVLGQRDQSQRRKIRESFREIYGKDLIDVLSSELSGDFMKAVVSWTYDPAERDARLVNKILNKEKKKKSLENLKVIVEISCTTSPNHLIAVRKAYCSLFDSSLEEHIASSLPFPLAKLLVTLASTFRYDKDRTDAEVATIEAAMLREAIEKKQLDHDHVLYILGTRSIYQLRETFVAYKKNYGVTIDKDVDGCP 229          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXD5_ARATH (Annexin D5 OS=Arabidopsis thaliana GN=ANN5 PE=2 SV=2)

HSP 1 Score: 146.362 bits (368), Expect = 1.567e-34
Identity = 77/228 (33.77%), Postives = 128/228 (56.14%), Query Frame = 2
Query:   50 MATLKVPTQTPSAAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEE-LIRILTTRSKAQINATLNHYNDAFGNAXHKDLKADPMMN 730
            MAT+K+P   PS   DA+QL KAF+G G + ++II++LAHRNA QR LI + Y   + +DL K L  EL    +++VLLW     ERDA +   + +   + +  + EI CTRS   L   KQ Y   +   LEED+    SG+ +++L+  ++T RY+G +++      +A+ ++  ++ K  + ++ LI+I T RS+  + A  + Y   +G    K ++ +   N
Sbjct:    1 MATMKIPMTVPSPRVDADQLFKAFKGRGCDTSVIINILAHRNATQRALIEQEYETKFSDDLRKRLHSELHGHLKKAVLLWMPEAVERDASILKRSLRGAVTDHKAIAEIICTRSGSQLRQIKQVYSNTFGVKLEEDIESEASGNHKRVLLAYLNTTRYEGPEIDNASVENDARTLKSAVARKHKSDDQTLIQIFTDRSRTHLVAVRSTYRSMYGKELGKAIRDETRGN 228          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANXD4_ARATH (Annexin D4 OS=Arabidopsis thaliana GN=ANN4 PE=2 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 3.059e-30
Identity = 76/217 (35.02%), Postives = 122/217 (56.22%), Query Frame = 2
Query:   80 PSAAEDAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDK-------ELSSDFER---SVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKIS---DKDYAHEELIRILTTRSKAQINATLNHYNDAFGN 691
            P   E   +   A  G G +E  +IS L       RKL R+     + ED  +A +K        L  +F R   +V++W + P ERDA L  +A K+   +  +++E++CTRS+ DL  A++AYH+ + +S+EED+A H  G  RKLLV LVS +RY+G  V    A+++AKI+ + ++   ++    +E++RILTTRSK  +     H+N+  G+
Sbjct:    4 PLELESLTEAISAGMGMGVDENALISTLGKSQKEHRKLFRKASKSFFVEDEERAFEKCHDHFVRHLKLEFSRFNTAVVMWAMHPWERDARLVKKALKKGEEAYNLIVEVSCTRSAEDLLGARKAYHSLFDQSMEEDIASHVHGPQRKLLVGLVSAYRYEGNKVKDDSAKSDAKILAEAVASSGEEAVEKDEVVRILTTRSKLHLQHLYKHFNEIKGS 220          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANX13_HUMAN (Annexin A13 OS=Homo sapiens GN=ANXA13 PE=1 SV=3)

HSP 1 Score: 129.413 bits (324), Expect = 1.983e-29
Identity = 76/200 (38.00%), Postives = 119/200 (59.50%), Query Frame = 2
Query:   95 DAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEELI--RILTTRSKAQINATLNHYNDAFG 688
            DA++L+KA +G GTNEA II +L+ R + +R+ I++ Y  TYG++L + L  ELS +FE++ L     P+E  A    +A K L +   VL+E+ CTR+++++ A K+AY   + +SLE DV   TSG+ +K+LV L+   R +G DV+  LA  +AK + D   +  +  +EL    +L  RS  Q+ AT   Y    G
Sbjct:   19 DAKKLNKACKGMGTNEAAIIEILSGRTSDERQQIKQKYKATYGKELEEVLKSELSGNFEKTALALLDRPSEYAARQLQKAMKGLGTDESVLIEVLCTRTNKEIIAIKEAYQRLFDRSLESDVKGDTSGNLKKILVSLLQANRNEGDDVDKDLAGQDAKDLYD-AGEGRWGTDELAFNEVLAKRSYKQLRATFQAYQILIG 217          

HSP 2 Score: 79.337 bits (194), Expect = 2.353e-14
Identity = 49/145 (33.79%), Postives = 77/145 (53.10%), Query Frame = 2
Query:   86 AAEDAEQLHKAFQG-WGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNW---VLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLV 508
            A +DA+ L+ A +G WGT+E     VLA R+  Q +   + Y    G+D+ +A+++E S D +++ L       + + Y A    K +  +      L+ I  TR+  DL   K  +  +Y+KSL + V   TSGDFRKLLV L+
Sbjct:  171 AGQDAKDLYDAGEGRWGTDELAFNEVLAKRSYKQLRATFQAYQILIGKDIEEAIEEETSGDLQKAYLTLVRCAQDCEDYFAERLYKSMKGAGTDEETLIRIVVTRAEVDLQGIKAKFQEKYQKSLSDMVRSDTSGDFRKLLVALL 315          
BLAST of FC920697 vs. ExPASy Swiss-Prot
Match: ANX13_CANFA (Annexin A13 OS=Canis familiaris GN=ANXA13 PE=1 SV=2)

HSP 1 Score: 129.028 bits (323), Expect = 2.589e-29
Identity = 75/195 (38.46%), Postives = 117/195 (60.00%), Query Frame = 2
Query:   95 DAEQLHKAFQGWGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNWVLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLVSTFRYDGGDVNMMLARTEAKIIRDKISDKDYAHEELI--RILTTRSKAQINATLNHY 673
            DA++L+KA +G GT+EA II +L+ R + +R+ I++ Y  TYG+DL +    +LS +FE++ L     P+E DA    +A K L +   VL+EI CTR+++++ A K+AY   + +SLE DV   TSG+ + +LV L+   R +G DV+  LA  +AK + D   D  +  +EL    +L  RS  Q+ AT   Y
Sbjct:   19 DAKKLNKACKGMGTDEAAIIEILSSRTSDERQQIKQKYKATYGKDLEEVFKSDLSGNFEKTALALLDRPSEYDARQLQKAMKGLGTDEAVLIEILCTRTNKEIMAIKEAYQRLFDRSLESDVKADTSGNLKAILVSLLQANRDEGDDVDKDLAGQDAKDLYD-AGDGRWGTDELAFNEVLAKRSHKQLRATFQAY 212          

HSP 2 Score: 75.8702 bits (185), Expect = 2.601e-13
Identity = 47/145 (32.41%), Postives = 76/145 (52.41%), Query Frame = 2
Query:   86 AAEDAEQLHKAFQG-WGTNEALIISVLAHRNAAQRKLIREIYNETYGEDLLKALDKELSSDFERSVLLWTLTPAERDAYLANEATKRLTSSNW---VLMEIACTRSSRDLFAAKQAYHARYKKSLEEDVAYHTSGDFRKLLVPLV 508
            A +DA+ L+ A  G WGT+E     VLA R+  Q +   + Y     +D+ +A++ E S D +++ L       +++ Y A+   K +  +      L+ I  TR+  DL   K  +  +Y+KSL + V   TSGDF+KLLV L+
Sbjct:  171 AGQDAKDLYDAGDGRWGTDELAFNEVLAKRSHKQLRATFQAYQILIDKDIEEAIEAETSGDLQKAYLTLVRCARDQEGYFADRLYKSMKGTGTDEETLIHIIVTRAEVDLQGIKAKFQEKYQKSLSDMVRSDTSGDFQKLLVALL 315          
The following BLAST results are available for this feature:
BLAST of FC920697 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 85
Match NameE-valueIdentityDescription
ANXD2_ARATH9.995e-9071.30Annexin D2 OS=Arabidopsis thaliana GN=ANN2 PE=2 SV... [more]
ANXD7_ARATH3.009e-8670.40Annexin D7 OS=Arabidopsis thaliana GN=ANNAT7 PE=2 ... [more]
ANXD1_ARATH4.067e-8368.78Annexin D1 OS=Arabidopsis thaliana GN=ANN1 PE=1 SV... [more]
ANXD6_ARATH1.546e-8267.56Annexin D6 OS=Arabidopsis thaliana GN=ANN6 PE=2 SV... [more]
ANX4_FRAAN1.273e-6055.45Annexin-like protein RJ4 OS=Fragaria ananassa PE=2... [more]
ANXD3_ARATH1.197e-4241.92Annexin D3 OS=Arabidopsis thaliana GN=ANN3 PE=2 SV... [more]
ANXD5_ARATH1.567e-3433.77Annexin D5 OS=Arabidopsis thaliana GN=ANN5 PE=2 SV... [more]
ANXD4_ARATH3.059e-3035.02Annexin D4 OS=Arabidopsis thaliana GN=ANN4 PE=2 SV... [more]
ANX13_HUMAN1.983e-2938.00Annexin A13 OS=Homo sapiens GN=ANXA13 PE=1 SV=3[more]
ANX13_CANFA2.589e-2938.46Annexin A13 OS=Canis familiaris GN=ANXA13 PE=1 SV=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32011H05EF RVDevelop1 Citrus clementina cDNA clone C32011H05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920697 ID=FC920697|Name=FC920697|organism=Citrus clementina|type=EST|length=741bp
GACTGCCTCGTCATTTTCTATTTTACAAAAACGCTGAAACAAATCGACAA
TGGCGACCCTTAAAGTGCCAACCCAGACCCCTTCTGCTGCTGAGGATGCT
GAGCAACTCCACAAAGCCTTCCAAGGATGGGGCACGAATGAGGCCCTCAT
TATATCTGTCTTGGCTCACAGAAATGCAGCTCAGCGCAAGTTGATTCGAG
AAATCTACAACGAAACTTATGGGGAAGACCTTCTTAAAGCACTGGACAAA
GAACTTTCAAGTGACTTTGAGAGATCTGTACTGCTATGGACATTGACTCC
TGCTGAGCGTGATGCTTATTTGGCAAATGAAGCGACAAAGAGATTGACTT
CAAGCAACTGGGTTCTCATGGAAATTGCCTGTACTAGATCTTCAAGAGAC
CTATTTGCTGCAAAGCAGGCCTACCATGCTCGTTACAAGAAATCCCTAGA
GGAAGATGTTGCATATCACACATCTGGGGACTTCCGCAAGCTTTTGGTTC
CTCTTGTGAGCACATTTCGATATGATGGAGGAGATGTGAACATGATGTTG
GCAAGAACTGAGGCTAAGATTATCCGTGACAAGATTTCAGACAAGGATTA
TGCTCATGAGGAGCTTATCAGGATTCTGACTACAAGGAGCAAGGCACAGA
TAAATGCGACCCTCAATCACTACAATGATGCTTTTGGAAATGCCATNCAC
AAGGATTTGAAGGCTGATCCCATGATGAATACCTCAACTGC
back to top