FC920926

Overview
NameFC920926
Unique NameFC920926
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length689
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC920926_ssr674 microsatellite FC920926_ssr674:674..685. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig10203 contig Ccv1_Contig10203:12..700. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920926 vs. ExPASy Swiss-Prot
Match: RAN_VICFA (GTP-binding nuclear protein Ran/TC4 OS=Vicia faba PE=2 SV=1)

HSP 1 Score: 402.905 bits (1034), Expect = 8.198e-112
Identity = 191/193 (98.96%), Postives = 191/193 (98.96%), Query Frame = 1
Query:   64 MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQFAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQID 642
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQ AIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFVESPALAPPEVQID
Sbjct:    1 MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDANLHFVESPALAPPEVQID 193          
BLAST of FC920926 vs. ExPASy Swiss-Prot
Match: RANB1_TOBAC (GTP-binding nuclear protein Ran-B1 OS=Nicotiana tabacum GN=RAN-B1 PE=2 SV=1)

HSP 1 Score: 402.905 bits (1034), Expect = 8.198e-112
Identity = 191/193 (98.96%), Postives = 191/193 (98.96%), Query Frame = 1
Query:   64 MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQFAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQID 642
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQ AIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFVESPALAPPEVQID
Sbjct:    1 MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDANLHFVESPALAPPEVQID 193          
BLAST of FC920926 vs. ExPASy Swiss-Prot
Match: RAN3_ARATH (GTP-binding nuclear protein Ran-3 OS=Arabidopsis thaliana GN=RAN3 PE=1 SV=2)

HSP 1 Score: 402.905 bits (1034), Expect = 8.198e-112
Identity = 191/193 (98.96%), Postives = 191/193 (98.96%), Query Frame = 1
Query:   64 MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQFAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQID 642
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQ AIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFVESPALAPPEVQID
Sbjct:    1 MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDANLHFVESPALAPPEVQID 193          
BLAST of FC920926 vs. ExPASy Swiss-Prot
Match: RAN2_SOLLC (GTP-binding nuclear protein Ran2 OS=Solanum lycopersicum GN=RAN2 PE=2 SV=1)

HSP 1 Score: 402.519 bits (1033), Expect = 1.071e-111
Identity = 191/193 (98.96%), Postives = 191/193 (98.96%), Query Frame = 1
Query:   64 MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQFAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQID 642
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQ AIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFVESPALAPPEVQID
Sbjct:    1 MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDGNLHFVESPALAPPEVQID 193          
BLAST of FC920926 vs. ExPASy Swiss-Prot
Match: RANA1_TOBAC (GTP-binding nuclear protein Ran-A1 OS=Nicotiana tabacum GN=RAN-A1 PE=2 SV=1)

HSP 1 Score: 401.749 bits (1031), Expect = 1.826e-111
Identity = 190/193 (98.45%), Postives = 190/193 (98.45%), Query Frame = 1
Query:   64 MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQFAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQID 642
            MALP QQ VDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQ AIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQID
Sbjct:    1 MALPGQQAVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQID 193          
BLAST of FC920926 vs. ExPASy Swiss-Prot
Match: RAN1_SOLLC (GTP-binding nuclear protein Ran1 OS=Solanum lycopersicum GN=RAN1 PE=2 SV=1)

HSP 1 Score: 400.593 bits (1028), Expect = 4.069e-111
Identity = 190/193 (98.45%), Postives = 190/193 (98.45%), Query Frame = 1
Query:   64 MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQFAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQID 642
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQ AIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFVESPALAPPEV ID
Sbjct:    1 MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDGNLHFVESPALAPPEVHID 193          
BLAST of FC920926 vs. ExPASy Swiss-Prot
Match: RAN2_ARATH (GTP-binding nuclear protein Ran-2 OS=Arabidopsis thaliana GN=RAN2 PE=1 SV=3)

HSP 1 Score: 400.208 bits (1027), Expect = 5.314e-111
Identity = 189/193 (97.93%), Postives = 190/193 (98.45%), Query Frame = 1
Query:   64 MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQFAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQID 642
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQ AIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFVESPALAPPEV +D
Sbjct:    1 MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDQNLHFVESPALAPPEVHLD 193          
BLAST of FC920926 vs. ExPASy Swiss-Prot
Match: RAN1_ARATH (GTP-binding nuclear protein Ran-1 OS=Arabidopsis thaliana GN=RAN1 PE=1 SV=1)

HSP 1 Score: 399.823 bits (1026), Expect = 6.940e-111
Identity = 189/193 (97.93%), Postives = 190/193 (98.45%), Query Frame = 1
Query:   64 MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQFAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQID 642
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQ AIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGD NLHFVE+PALAPPEV ID
Sbjct:    1 MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDQNLHFVETPALAPPEVHID 193          
BLAST of FC920926 vs. ExPASy Swiss-Prot
Match: RAN1_ORYSJ (GTP-binding nuclear protein Ran-1 OS=Oryza sativa subsp. japonica GN=RAN1 PE=2 SV=1)

HSP 1 Score: 396.356 bits (1017), Expect = 7.673e-110
Identity = 186/193 (96.37%), Postives = 190/193 (98.45%), Query Frame = 1
Query:   64 MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQFAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQID 642
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQ AIIMFDVT+RLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYE+SAKSNYNFEKPFLYLARKLAGD NLHFVE+PALAPP+V ID
Sbjct:    1 MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTSRLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEVSAKSNYNFEKPFLYLARKLAGDGNLHFVETPALAPPDVTID 193          
BLAST of FC920926 vs. ExPASy Swiss-Prot
Match: RAN1_ORYSI (GTP-binding nuclear protein Ran-1 OS=Oryza sativa subsp. indica GN=RAN1 PE=2 SV=2)

HSP 1 Score: 396.356 bits (1017), Expect = 7.673e-110
Identity = 186/193 (96.37%), Postives = 190/193 (98.45%), Query Frame = 1
Query:   64 MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQFAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQID 642
            MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQ AIIMFDVT+RLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYE+SAKSNYNFEKPFLYLARKLAGD NLHFVE+PALAPP+V ID
Sbjct:    1 MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTSRLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEVSAKSNYNFEKPFLYLARKLAGDGNLHFVETPALAPPDVTID 193          
The following BLAST results are available for this feature:
BLAST of FC920926 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
RAN_VICFA8.198e-11298.96GTP-binding nuclear protein Ran/TC4 OS=Vicia faba ... [more]
RANB1_TOBAC8.198e-11298.96GTP-binding nuclear protein Ran-B1 OS=Nicotiana ta... [more]
RAN3_ARATH8.198e-11298.96GTP-binding nuclear protein Ran-3 OS=Arabidopsis t... [more]
RAN2_SOLLC1.071e-11198.96GTP-binding nuclear protein Ran2 OS=Solanum lycope... [more]
RANA1_TOBAC1.826e-11198.45GTP-binding nuclear protein Ran-A1 OS=Nicotiana ta... [more]
RAN1_SOLLC4.069e-11198.45GTP-binding nuclear protein Ran1 OS=Solanum lycope... [more]
RAN2_ARATH5.314e-11197.93GTP-binding nuclear protein Ran-2 OS=Arabidopsis t... [more]
RAN1_ARATH6.940e-11197.93GTP-binding nuclear protein Ran-1 OS=Arabidopsis t... [more]
RAN1_ORYSJ7.673e-11096.37GTP-binding nuclear protein Ran-1 OS=Oryza sativa ... [more]
RAN1_ORYSI7.673e-11096.37GTP-binding nuclear protein Ran-1 OS=Oryza sativa ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32014H06EF RVDevelop1 Citrus clementina cDNA clone C32014H06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920926 ID=FC920926|Name=FC920926|organism=Citrus clementina|type=EST|length=689bp
ACATTCCCCGACACTCAGCGCTCTCTCGCTTAAATTCAAAATCCAAACGC
AACAAATCAACTCATGGCTCTGCCGAATCAGCAAACTGTTGATTATCCAA
GCTTCAAACTTGTAATTGTCGGCGATGGTGGCACTGGGAAGACTACCTTT
GTGAAGAGGCATCTTACTGGTGAATTCGAGAAGAAATATGAACCGACCAT
TGGTGTGGAAGTTCATCCATTGGACTTCTTTACCAACTGTGGAAAAATAC
GATTCTATTGCTGGGACACTGCCGGACAAGAGAAGTTTGGTGGTCTTAGA
GATGGATACTACATCCATGGGCAATTTGCTATCATCATGTTTGATGTTAC
TGCCCGCTTGACGTATAAGAATGTTCCGACGTGGCACCGTGATCTCTGCA
GGGTGTGTGAAAACATCCCAATTGTTCTTTGCGGGAACAAGGTCGATGTG
AAGAACAGGCAGGTGAAAGCAAAGCAGGTTACTTTCCACAGGAAGAAGAA
TTTGCAGTACTATGAGATCTCAGCCAAGAGCAATTACAACTTTGAGAAGC
CTTTTCTTTACCTTGCCAGAAAACTTGCTGGGGATCCTAACTTGCATTTT
GTCGAGTCTCCTGCCCTTGCTCCCCCAGAGGTGCAAATCGATTTGGCTGC
TACACTACACATGAAGCTGAACTTGCTGCTGCTGCTAGT
back to top