FC920930

Overview
NameFC920930
Unique NameFC920930
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length678
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC920930_ssr17 microsatellite FC920930_ssr17:17..26. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig14355 contig Ccv1_Contig14355:11..688. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920930 vs. ExPASy Swiss-Prot
Match: KING1_ARATH (SNF1-related protein kinase regulatory subunit gamma 1 OS=Arabidopsis thaliana GN=KING1 PE=1 SV=2)

HSP 1 Score: 216.853 bits (551), Expect = 1.974e-56
Identity = 115/177 (64.97%), Postives = 131/177 (74.01%), Query Frame = 2
Query:  116 EAQLGMKVEDLWDVLEPQLSPTEKLNACFESIPVEAFP-PPPSQVIEIKSDTSLAEAVEILAQHRILSAPVVDVDAPEDASWIDRYIGIVEFAGIAVWILHQXXXXXXXXXXXXXXXXXXVNGMSKAALFKDLGPESASMTSGNFFEALTTSEFYKNTKVRDIAGSFRWAPFLALQK 643
            EA+LGM+VEDLWD  +PQLSP EKLNACFESIPV AFP    SQ IEI+SDTSLAEAV+ L++ ++LSAPVVDVDAPEDASWIDRYIGIVEF GI VW+LHQ                   NG S       L    +++TSGNFFE LT+SE YKNTKVRDI+G+FRWAPFLALQK
Sbjct:   25 EAKLGMRVEDLWDEQKPQLSPNEKLNACFESIPVSAFPLSSDSQDIEIRSDTSLAEAVQTLSKFKVLSAPVVDVDAPEDASWIDRYIGIVEFPGIVVWLLHQLEPPSPRSPAVAAS-----NGFSHDFTTDVLDNGDSAVTSGNFFEVLTSSELYKNTKVRDISGTFRWAPFLALQK 196          

HSP 2 Score: 23.8682 bits (50), Expect = 1.974e-56
Identity = 11/11 (100.00%), Postives = 11/11 (100.00%), Query Frame = 1
Query:  646 NSFLTMLLLLS 678
            NSFLTMLLLLS
Sbjct:  198 NSFLTMLLLLS 208          
The following BLAST results are available for this feature:
BLAST of FC920930 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
KING1_ARATH1.974e-5664.97SNF1-related protein kinase regulatory subunit gam... [more]
back to top
Properties
Property NameValue
Genbank descriptionC32014H11EF RVDevelop1 Citrus clementina cDNA clone C32014H11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920930 ID=FC920930|Name=FC920930|organism=Citrus clementina|type=EST|length=678bp
GAATCGAGAATTTCAAAGAGAGAGAGAAGAGTTGAGAGCGTTCGTATTGA
TGGCGAGTGTGCAATTTCTGCCACAAGGGAGTAGTCCAAGGCAACAGGAT
AGTCCTCGGAGTCCAGAGGCGCAGCTGGGGATGAAAGTGGAGGATTTGTG
GGACGTTTTGGAACCACAGCTGAGTCCCACGGAGAAGCTCAACGCCTGCT
TTGAAAGCATCCCTGTTGAGGCTTTCCCTCCTCCGCCTTCACAAGTGATT
GAGATAAAATCGGACACCAGTCTAGCTGAAGCGGTTGAAATACTGGCCCA
ACACAGAATTCTTAGTGCTCCTGTAGTGGATGTTGATGCACCTGAGGATG
CTAGTTGGATAGACAGATACATTGGCATTGTTGAGTTTGCAGGAATTGCC
GTATGGATTTTGCATCAGTCAGAACCTCCTTCTCCAAGGAGTTCATCCCC
TAGTTCTGCTTTGGCTGCAGCAGTTAATGGCATGTCTAAGGCTGCTCTAT
TTAAGGATTTAGGCCCTGAATCTGCTTCAATGACTTCCGGAAACTTTTTT
GAAGCTTTGACTACTTCTGAATTCTATAAGAACACTAAGGTACGAGACAT
CGCAGGGTCATTTCGCTGGGCTCCATTCCTTGCTCTGCAGAAATCAACTC
CTTCTTGACCATGCTTCTGTTGCTTTCA
back to top