FC923315
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of FC923315 vs. ExPASy Swiss-Prot
Match: UCRIA_PEA (Cytochrome b6-f complex iron-sulfur subunit, chloroplastic OS=Pisum sativum GN=petC PE=2 SV=1) HSP 1 Score: 89.3521 bits (220), Expect = 6.394e-18 Identity = 46/66 (69.70%), Postives = 50/66 (75.76%), Query Frame = 2 Query: 98 KSGMFCPSRAFLVKPARTQMVTKNPMGMKIKCQATSIPADRVPDMGKRQLMNLLLLRADSLPTGFM 295 KSG+ CPS A LVKP RTQM + GMKI CQATSIPADRVPDM KR+ +NLLLL A SLPT M Sbjct: 18 KSGISCPSIALLVKPTRTQMTGRGNKGMKITCQATSIPADRVPDMSKRKTLNLLLLGALSLPTAGM 83
BLAST of FC923315 vs. ExPASy Swiss-Prot
Match: UCRIA_FRIAG (Cytochrome b6-f complex iron-sulfur subunit, chloroplastic OS=Fritillaria agrestis GN=petC PE=2 SV=1) HSP 1 Score: 78.1814 bits (191), Expect = 1.474e-14 Identity = 42/66 (63.64%), Postives = 46/66 (69.70%), Query Frame = 2 Query: 98 KSGMFCPSRAFLVKPARTQMVTKNPMGMKIKCQATSIPADRVPDMGKRQLMNLLLLRADSLPTGFM 295 K+G + PSRA L K AR K + K+ CQATSIPADRVPDMGKRQ MNLLLL A SLPT M Sbjct: 19 KNGAYSPSRALLGKTARGLYPEKEMVSRKVTCQATSIPADRVPDMGKRQTMNLLLLGALSLPTAGM 84
BLAST of FC923315 vs. ExPASy Swiss-Prot
Match: UCRIA_ARATH (Cytochrome b6-f complex iron-sulfur subunit, chloroplastic OS=Arabidopsis thaliana GN=petC PE=1 SV=1) HSP 1 Score: 73.9442 bits (180), Expect = 2.780e-13 Identity = 38/68 (55.88%), Postives = 48/68 (70.59%), Query Frame = 2 Query: 98 KSGMFCPSRAFLVKPART--QMVTKNPMGMKIKCQATSIPADRVPDMGKRQLMNLLLLRADSLPTGFM 295 +S + S VKP + QMV K +G++I CQA+SIPADRVPDM KR+ +NLLLL A SLPTG+M Sbjct: 16 RSALMAMSSGLFVKPTKMNHQMVRKEKIGLRISCQASSIPADRVPDMEKRKTLNLLLLGALSLPTGYM 83
BLAST of FC923315 vs. ExPASy Swiss-Prot
Match: UCRIA_SPIOL (Cytochrome b6-f complex iron-sulfur subunit, chloroplastic OS=Spinacia oleracea GN=petC PE=1 SV=2) HSP 1 Score: 72.0182 bits (175), Expect = 1.056e-12 Identity = 40/68 (58.82%), Postives = 47/68 (69.12%), Query Frame = 2 Query: 98 KSGMFCPSRAFLVKPARTQMVTKNPM--GMKIKCQATSIPADRVPDMGKRQLMNLLLLRADSLPTGFM 295 K+GMF PS A L K R ++ GMK+ CQATSIPAD VPDM KR+ +NLLLL A SLPTG+M Sbjct: 18 KNGMFAPSLA-LAKAGRVNVLISKERIRGMKLTCQATSIPADNVPDMQKRETLNLLLLGALSLPTGYM 84 The following BLAST results are available for this feature:
BLAST of FC923315 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 4
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FC923315 ID=FC923315; Name=FC923315; organism=Citrus clementina; type=EST; length=295bpback to top |