FC931648
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FC931648 vs. ExPASy Swiss-Prot
Match: RL292_ARATH (60S ribosomal protein L29-2 OS=Arabidopsis thaliana GN=RPL29B PE=2 SV=2) HSP 1 Score: 103.219 bits (256), Expect = 8.204e-22 Identity = 47/60 (78.33%), Postives = 53/60 (88.33%), Query Frame = 1 Query: 121 MAKSKNHTAHNQSYKAYKNGIKKPKKHRHTSTKGMDPKFLRNQRYARKHNKSNGGSAEEE 300 MAKSKNHTAHNQS KA+KNGIKKP++HRHT T+GMDPKFLRNQRYARKHN +G +A E Sbjct: 1 MAKSKNHTAHNQSAKAHKNGIKKPRRHRHTPTRGMDPKFLRNQRYARKHNVKSGENAGVE 60
BLAST of FC931648 vs. ExPASy Swiss-Prot
Match: RL291_ARATH (60S ribosomal protein L29-1 OS=Arabidopsis thaliana GN=RPL29A PE=1 SV=1) HSP 1 Score: 103.219 bits (256), Expect = 8.204e-22 Identity = 47/60 (78.33%), Postives = 52/60 (86.67%), Query Frame = 1 Query: 121 MAKSKNHTAHNQSYKAYKNGIKKPKKHRHTSTKGMDPKFLRNQRYARKHNKSNGGSAEEE 300 MAKSKNHTAHNQS KA+KNGIKKP++HRHT T+GMDPKFLRNQRYARKHN G +A E Sbjct: 1 MAKSKNHTAHNQSAKAHKNGIKKPRRHRHTPTRGMDPKFLRNQRYARKHNVKAGENASAE 60
BLAST of FC931648 vs. ExPASy Swiss-Prot
Match: RL29_RAT (60S ribosomal protein L29 OS=Rattus norvegicus GN=Rpl29 PE=1 SV=3) HSP 1 Score: 82.4185 bits (202), Expect = 1.499e-15 Identity = 36/51 (70.59%), Postives = 43/51 (84.31%), Query Frame = 1 Query: 121 MAKSKNHTAHNQSYKAYKNGIKKPKKHRHTSTKGMDPKFLRNQRYARKHNK 273 MAKSKNHT HNQS K ++NGIKKP+ R+ S KG+DPKFLRN R+A+KHNK Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNK 51
BLAST of FC931648 vs. ExPASy Swiss-Prot
Match: RL29_PIG (60S ribosomal protein L29 OS=Sus scrofa GN=RPL29 PE=2 SV=4) HSP 1 Score: 82.4185 bits (202), Expect = 1.499e-15 Identity = 36/51 (70.59%), Postives = 43/51 (84.31%), Query Frame = 1 Query: 121 MAKSKNHTAHNQSYKAYKNGIKKPKKHRHTSTKGMDPKFLRNQRYARKHNK 273 MAKSKNHT HNQS K ++NGIKKP+ R+ S KG+DPKFLRN R+A+KHNK Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNK 51
BLAST of FC931648 vs. ExPASy Swiss-Prot
Match: RL29_MOUSE (60S ribosomal protein L29 OS=Mus musculus GN=Rpl29 PE=2 SV=2) HSP 1 Score: 82.4185 bits (202), Expect = 1.499e-15 Identity = 36/51 (70.59%), Postives = 43/51 (84.31%), Query Frame = 1 Query: 121 MAKSKNHTAHNQSYKAYKNGIKKPKKHRHTSTKGMDPKFLRNQRYARKHNK 273 MAKSKNHT HNQS K ++NGIKKP+ R+ S KG+DPKFLRN R+A+KHNK Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNK 51
BLAST of FC931648 vs. ExPASy Swiss-Prot
Match: RL29_MACFA (60S ribosomal protein L29 OS=Macaca fascicularis GN=RPL29 PE=2 SV=3) HSP 1 Score: 82.4185 bits (202), Expect = 1.499e-15 Identity = 36/51 (70.59%), Postives = 43/51 (84.31%), Query Frame = 1 Query: 121 MAKSKNHTAHNQSYKAYKNGIKKPKKHRHTSTKGMDPKFLRNQRYARKHNK 273 MAKSKNHT HNQS K ++NGIKKP+ R+ S KG+DPKFLRN R+A+KHNK Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNK 51
BLAST of FC931648 vs. ExPASy Swiss-Prot
Match: RL29_HUMAN (60S ribosomal protein L29 OS=Homo sapiens GN=RPL29 PE=1 SV=2) HSP 1 Score: 82.4185 bits (202), Expect = 1.499e-15 Identity = 36/51 (70.59%), Postives = 43/51 (84.31%), Query Frame = 1 Query: 121 MAKSKNHTAHNQSYKAYKNGIKKPKKHRHTSTKGMDPKFLRNQRYARKHNK 273 MAKSKNHT HNQS K ++NGIKKP+ R+ S KG+DPKFLRN R+A+KHNK Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNK 51
BLAST of FC931648 vs. ExPASy Swiss-Prot
Match: RL29_BOVIN (60S ribosomal protein L29 OS=Bos taurus GN=RPL29 PE=2 SV=3) HSP 1 Score: 82.4185 bits (202), Expect = 1.499e-15 Identity = 36/51 (70.59%), Postives = 43/51 (84.31%), Query Frame = 1 Query: 121 MAKSKNHTAHNQSYKAYKNGIKKPKKHRHTSTKGMDPKFLRNQRYARKHNK 273 MAKSKNHT HNQS K ++NGIKKP+ R+ S KG+DPKFLRN R+A+KHNK Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNK 51
BLAST of FC931648 vs. ExPASy Swiss-Prot
Match: RL29_DROME (60S ribosomal protein L29 OS=Drosophila melanogaster GN=RpL29 PE=1 SV=1) HSP 1 Score: 77.7962 bits (190), Expect = 3.691e-14 Identity = 38/58 (65.52%), Postives = 44/58 (75.86%), Query Frame = 1 Query: 121 MAKSKNHTAHNQSYKAYKNGIKKPKKHRHTSTKGMDPKFLRNQRYARKHNKSNGGSAE 294 MAKSKNHT HNQ+ KA++NGIK+P + RH ST GMD KFL NQRYARK N S S + Sbjct: 1 MAKSKNHTNHNQNKKAHRNGIKRPLRKRHESTLGMDVKFLINQRYARKGNLSREESVK 58
BLAST of FC931648 vs. ExPASy Swiss-Prot
Match: RL29_YEAST (60S ribosomal protein L29 OS=Saccharomyces cerevisiae GN=RPL29 PE=1 SV=3) HSP 1 Score: 72.0182 bits (175), Expect = 2.025e-12 Identity = 31/46 (67.39%), Postives = 40/46 (86.96%), Query Frame = 1 Query: 121 MAKSKNHTAHNQSYKAYKNGIKKPKKHRHTSTKGMDPKFLRNQRYA 258 MAKSKNHTAHNQ+ KA++NGIKKPK +++ S KG+DPKF RN ++A Sbjct: 1 MAKSKNHTAHNQTRKAHRNGIKKPKTYKYPSLKGVDPKFRRNHKHA 46 The following BLAST results are available for this feature:
BLAST of FC931648 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 11
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >FC931648 ID=FC931648; Name=FC931648; organism=Citrus clementina; type=EST; length=541bpback to top |