BQ623110

Overview
NameBQ623110
Unique NameBQ623110
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length623
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1260 contig Csv1_Contig1260:740..1360. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623110 vs. ExPASy Swiss-Prot
Match: CB21_GOSHI (Chlorophyll a-b binding protein 151, chloroplastic OS=Gossypium hirsutum GN=CAB-151 PE=2 SV=2)

HSP 1 Score: 163.31 bits (412), Expect = 2.792e-80
Identity = 79/100 (79.00%), Postives = 83/100 (83.00%), Query Frame = 2
Query:  230 VLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPDQFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLYDHIADPVANNAWAYATNFVPGK 529
            VLMGFVEGYR+                AFDPLGLADDPD FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPIENL+DH+ADPVANNAWAYATNFVPGK
Sbjct:  166 VLMGFVEGYRVGGGPLGEGLDPIYPGGAFDPLGLADDPDAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHLADPVANNAWAYATNFVPGK 265          

HSP 2 Score: 157.147 bits (396), Expect = 2.792e-80
Identity = 74/81 (91.36%), Postives = 75/81 (92.59%), Query Frame = 1
Query:    1 TFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACHACAYGF 243
            TFAKNRELEVIH RWAMLGALGCVFPEILSKNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILAIWAC     GF
Sbjct:   90 TFAKNRELEVIHCRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWACQVVLMGF 170          
BLAST of BQ623110 vs. ExPASy Swiss-Prot
Match: CB23_ORYSJ (Chlorophyll a-b binding protein, chloroplastic OS=Oryza sativa subsp. japonica GN=RCABP89 PE=2 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 6.197e-80
Identity = 80/100 (80.00%), Postives = 83/100 (83.00%), Query Frame = 2
Query:  230 VLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPDQFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLYDHIADPVANNAWAYATNFVPGK 529
            VLMGFVEGYR+                AFDPLGLADDPD FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENL+DH+ADPVANNAWAYATNFVPGK
Sbjct:  164 VLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPDTFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK 263          

HSP 2 Score: 154.836 bits (390), Expect = 6.197e-80
Identity = 73/81 (90.12%), Postives = 75/81 (92.59%), Query Frame = 1
Query:    1 TFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACHACAYGF 243
            TFA+NRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA      GF
Sbjct:   88 TFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGF 168          
BLAST of BQ623110 vs. ExPASy Swiss-Prot
Match: CB23_ORYSI (Chlorophyll a-b binding protein, chloroplastic OS=Oryza sativa subsp. indica GN=OsI_012078 PE=2 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 6.197e-80
Identity = 80/100 (80.00%), Postives = 83/100 (83.00%), Query Frame = 2
Query:  230 VLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPDQFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLYDHIADPVANNAWAYATNFVPGK 529
            VLMGFVEGYR+                AFDPLGLADDPD FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENL+DH+ADPVANNAWAYATNFVPGK
Sbjct:  164 VLMGFVEGYRVGGGPLGEGLDKVYPGGAFDPLGLADDPDTFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK 263          

HSP 2 Score: 154.836 bits (390), Expect = 6.197e-80
Identity = 73/81 (90.12%), Postives = 75/81 (92.59%), Query Frame = 1
Query:    1 TFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACHACAYGF 243
            TFA+NRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNL+HAQSILAIWA      GF
Sbjct:   88 TFARNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWAVQVVLMGF 168          
BLAST of BQ623110 vs. ExPASy Swiss-Prot
Match: CB24_SOLLC (Chlorophyll a-b binding protein 4, chloroplastic OS=Solanum lycopersicum GN=CAB4 PE=2 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 2.556e-78
Identity = 78/100 (78.00%), Postives = 81/100 (81.00%), Query Frame = 2
Query:  230 VLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPDQFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLYDHIADPVANNAWAYATNFVPGK 529
            VLMGFVEGYR+                AFDPLGLADDP+ FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPIENL DHI DPVANNAWAYATNFVPGK
Sbjct:  166 VLMGFVEGYRVGGGPLGEGLDKIYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLSDHINDPVANNAWAYATNFVPGK 265          

HSP 2 Score: 155.606 bits (392), Expect = 2.556e-78
Identity = 72/81 (88.89%), Postives = 75/81 (92.59%), Query Frame = 1
Query:    1 TFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACHACAYGF 243
            TFA+NRELEVIH RWAMLGALGCVFPEILSKNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNL+HAQSILAIWAC     GF
Sbjct:   90 TFARNRELEVIHCRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAIWACQVVLMGF 170          
BLAST of BQ623110 vs. ExPASy Swiss-Prot
Match: CB215_PEA (Chlorophyll a-b binding protein 215, chloroplastic OS=Pisum sativum GN=CAB215 PE=1 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 1.641e-77
Identity = 78/100 (78.00%), Postives = 83/100 (83.00%), Query Frame = 2
Query:  230 VLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPDQFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLYDHIADPVANNAWAYATNFVPGK 529
            VLMGFVEGYR+                AFDPLGLADDPD FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPI+NLYDH+ADPVANNAWA+ATNFVPG+
Sbjct:  166 VLMGFVEGYRVGGGPLGEGLDPLYPGGAFDPLGLADDPDSFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIQNLYDHVADPVANNAWAFATNFVPGQ 265          

HSP 2 Score: 149.058 bits (375), Expect = 1.641e-77
Identity = 69/81 (85.19%), Postives = 73/81 (90.12%), Query Frame = 1
Query:    1 TFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACHACAYGF 243
            TFA+NRELEVIHSRWAMLGALGC FPE+L KNGVKFGEAVWFKAG+QIF+EGGLDYLGNPNLIHAQSILAIWA      GF
Sbjct:   90 TFARNRELEVIHSRWAMLGALGCTFPELLEKNGVKFGEAVWFKAGSQIFAEGGLDYLGNPNLIHAQSILAIWATQVVLMGF 170          
BLAST of BQ623110 vs. ExPASy Swiss-Prot
Match: CB23_TOBAC (Chlorophyll a-b binding protein 36, chloroplastic OS=Nicotiana tabacum GN=CAB36 PE=3 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 8.079e-77
Identity = 76/100 (76.00%), Postives = 82/100 (82.00%), Query Frame = 2
Query:  230 VLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPDQFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLYDHIADPVANNAWAYATNFVPGK 529
            VLMG +EGYR+                AFDPLGLADDP+ FAELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPIENL+DH+ADPVANNAWAYATNFVPGK
Sbjct:  166 VLMGLIEGYRVGGGPLGEGLDKIYPGGAFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLFDHVADPVANNAWAYATNFVPGK 265          

HSP 2 Score: 149.443 bits (376), Expect = 8.079e-77
Identity = 70/80 (87.50%), Postives = 73/80 (91.25%), Query Frame = 1
Query:    1 TFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACHACAYG 240
            TFA+NRELEVIH RWAMLGALGCVFPEILSKNGVKFGEAVWFKAG+QIFSEGGLDYLGNPNLIHAQSILA+WA      G
Sbjct:   90 TFARNRELEVIHCRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAVWASQVVLMG 169          
BLAST of BQ623110 vs. ExPASy Swiss-Prot
Match: CB21_PINTH (Chlorophyll a-b binding protein type I, chloroplastic OS=Pinus thunbergii PE=2 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 1.054e-76
Identity = 76/100 (76.00%), Postives = 81/100 (81.00%), Query Frame = 2
Query:  230 VLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPDQFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLYDHIADPVANNAWAYATNFVPGK 529
            VLMG +EGYR+                AFDPLGLADDP+  AELKVKE+KNGRLAMFSMFGFFVQAIVTGKGPIENLYDH+ADPVANNAWAYATNFVPGK
Sbjct:  167 VLMGLIEGYRVGGGTLGEGLDPLLPGGAFDPLGLADDPEACAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPIENLYDHLADPVANNAWAYATNFVPGK 266          

HSP 2 Score: 150.984 bits (380), Expect = 1.054e-76
Identity = 70/80 (87.50%), Postives = 73/80 (91.25%), Query Frame = 1
Query:    1 TFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACHACAYG 240
            TFAKNRELEVIH RWAMLGALGCVFPE+L+KNG+KFGEAVWFKAGAQIFSEGGLDY GNPNLIHAQSILAIWAC     G
Sbjct:   91 TFAKNRELEVIHCRWAMLGALGCVFPELLAKNGLKFGEAVWFKAGAQIFSEGGLDYAGNPNLIHAQSILAIWACQVVLMG 170          
BLAST of BQ623110 vs. ExPASy Swiss-Prot
Match: CB21_CUCSA (Chlorophyll a-b binding protein of LHCII type I, chloroplastic (Fragment) OS=Cucumis sativus PE=2 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 5.189e-76
Identity = 76/100 (76.00%), Postives = 80/100 (80.00%), Query Frame = 2
Query:  230 VLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPDQFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLYDHIADPVANNAWAYATNFVPGK 529
            VLMG VEGYRI                +FDPLGLADDP+ FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGP+ENL DH+ADPV NNAWAYATNFVPGK
Sbjct:  156 VLMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 255          

HSP 2 Score: 152.525 bits (384), Expect = 5.189e-76
Identity = 70/80 (87.50%), Postives = 75/80 (93.75%), Query Frame = 1
Query:    1 TFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACHACAYG 240
            TFAKNRELEVIHSRWAMLGALGCVFPE+LS+NGVKFGEAVWFKAG+QIFSEGGLDYLGNP+L+HAQSILAIWAC     G
Sbjct:   80 TFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMG 159          
BLAST of BQ623110 vs. ExPASy Swiss-Prot
Match: CB21_MAIZE (Chlorophyll a-b binding protein 1, chloroplastic OS=Zea mays GN=CAB1 PE=3 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 8.825e-76
Identity = 71/80 (88.75%), Postives = 75/80 (93.75%), Query Frame = 1
Query:    1 TFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACHACAYG 240
            TFAKNRELEVIHSRWAMLGALGCVFPE+LS+NGVKFGEAVWFKAG+QIFSEGGLDYLGNP+LIHAQSILAIWAC     G
Sbjct:   87 TFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMG 166          

HSP 2 Score: 152.525 bits (384), Expect = 8.825e-76
Identity = 76/99 (76.77%), Postives = 79/99 (79.80%), Query Frame = 2
Query:  230 VLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPDQFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLYDHIADPVANNAWAYATNFVPG 526
            VLMG VEGYRI                +FDPLGLADDP+ FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGP+ENL DHIADPV NNAWAYATNFVPG
Sbjct:  163 VLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHIADPVNNNAWAYATNFVPG 261          
BLAST of BQ623110 vs. ExPASy Swiss-Prot
Match: CB22_CUCSA (Chlorophyll a-b binding protein of LHCII type 1 (Fragment) OS=Cucumis sativus PE=2 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 2.559e-75
Identity = 76/100 (76.00%), Postives = 80/100 (80.00%), Query Frame = 2
Query:  230 VLMGFVEGYRIXXXXXXXXXXXXXXXXAFDPLGLADDPDQFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPIENLYDHIADPVANNAWAYATNFVPGK 529
            VLMG VEGYRI                +FDPLGLADDP+ FAELKVKELKNGRLAMFSMFGFFVQAIVTGKGP+ENL DH+ADPV NNAWAYATNFVPGK
Sbjct:  107 VLMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 206          

HSP 2 Score: 150.214 bits (378), Expect = 2.559e-75
Identity = 69/80 (86.25%), Postives = 74/80 (92.50%), Query Frame = 1
Query:    1 TFAKNRELEVIHSRWAMLGALGCVFPEILSKNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACHACAYG 240
            TFAKNRELEVIHS WAMLGALGCVFPE+LS+NGVKFGEAVWFKAG+QIFSEGGLDYLGNP+L+HAQSILAIWAC     G
Sbjct:   31 TFAKNRELEVIHSTWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLMG 110          
The following BLAST results are available for this feature:
BLAST of BQ623110 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 74
Match NameE-valueIdentityDescription
CB21_GOSHI2.792e-8079.00Chlorophyll a-b binding protein 151, chloroplastic... [more]
CB23_ORYSJ6.197e-8080.00Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB23_ORYSI6.197e-8080.00Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB24_SOLLC2.556e-7878.00Chlorophyll a-b binding protein 4, chloroplastic O... [more]
CB215_PEA1.641e-7778.00Chlorophyll a-b binding protein 215, chloroplastic... [more]
CB23_TOBAC8.079e-7776.00Chlorophyll a-b binding protein 36, chloroplastic ... [more]
CB21_PINTH1.054e-7676.00Chlorophyll a-b binding protein type I, chloroplas... [more]
CB21_CUCSA5.189e-7676.00Chlorophyll a-b binding protein of LHCII type I, c... [more]
CB21_MAIZE8.825e-7688.75Chlorophyll a-b binding protein 1, chloroplastic O... [more]
CB22_CUCSA2.559e-7576.00Chlorophyll a-b binding protein of LHCII type 1 (F... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00201 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00201 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623110 ID=BQ623110|Name=BQ623110|organism=Citrus sinensis|type=EST|length=623bp
ACATTTGCTAAGAACCGTGAGCTAGAGGTGATCCACAGCAGATGGGCAAT
GCTTGGAGCTCTTGGCTGCGTCTTCCCTGAAATCCTCTCCAAGAATGGAG
TGAAGTTCGGCGAAGCAGTTTGGTTCAAGGCTGGCGCTCAAATATTCTCT
GAAGGTGGCCTTGACTATCTTGGCAACCCCAACCTCATTCATGCTCAGAG
CATTTTGGCTATCTGGGCCTGCCACGCCTGTGCTTATGGGTTTTGTTGAA
GGATACAGAATTGGTGGCGGTCCTCTTGGTGAAGGACTTGACCCACTTTA
CCCTGGTGGTGCTTTTGACCCACTTGGTTTGGCTGATGACCCCGATCAAT
TTGCTGAGTTGAAGGTCAAGGAGCTCAAGAATGGCCGTCTGGCTATGTTC
TCCATGTTTGGATTCTTTGTTCAGGCTATTGTCACTGGGAAGGGTCCAAT
TGAGAACCTCTACGACCACATTGCTGATCCTGTGGCCAACAATGCCTGGG
CTTATGCCACTAACTTTGTTCCCGGAAAGTAAAGAAACTCATGACTTGAT
GGGGGTCTTTTTCAGCTGTAACATTATTCTATGTATCGTATGTGCTTTTG
GGGAAACTCTGTCATGGACTTAT
back to top