BQ623117

Overview
NameBQ623117
Unique NameBQ623117
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length522
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4747 contig Csv1_Contig4747:19..540. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623117 vs. ExPASy Swiss-Prot
Match: IF2H_MOUSE (Eukaryotic translation initiation factor 2 subunit 3, Y-linked OS=Mus musculus GN=Eif2s3y PE=2 SV=2)

HSP 1 Score: 112.079 bits (279), Expect = 1.992e-28
Identity = 53/76 (69.74%), Postives = 63/76 (82.89%), Query Frame = 1
Query:   52 ERQGKVSKLAKQEILMLNIGSMSTGARVLAVKNDLAKLQLTSPVCTSRGEKIALSRRVEKHWRLIGWGQIQAGTTL 279
            ++  KV KL+K E+LM+NIGS+STG RV AVK DL K+ LT+PVCT  GEKIALSRRVEKHWRLIGWGQI+ G T+
Sbjct:  390 KKAAKVQKLSKNEVLMVNIGSLSTGGRVSAVKADLGKIVLTNPVCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTI 465          

HSP 2 Score: 33.4982 bits (75), Expect = 1.992e-28
Identity = 15/21 (71.43%), Postives = 19/21 (90.48%), Query Frame = 3
Query:    3 NFFLLRRLLGVRTKGLRKAGK 65
            ++FLLRRLLGVRT+G +KA K
Sbjct:  374 SYFLLRRLLGVRTEGDKKAAK 394          
BLAST of BQ623117 vs. ExPASy Swiss-Prot
Match: IF2G_RAT (Eukaryotic translation initiation factor 2 subunit 3 OS=Rattus norvegicus GN=Eif2s3 PE=1 SV=2)

HSP 1 Score: 112.079 bits (279), Expect = 1.992e-28
Identity = 53/76 (69.74%), Postives = 63/76 (82.89%), Query Frame = 1
Query:   52 ERQGKVSKLAKQEILMLNIGSMSTGARVLAVKNDLAKLQLTSPVCTSRGEKIALSRRVEKHWRLIGWGQIQAGTTL 279
            ++  KV KL+K E+LM+NIGS+STG RV AVK DL K+ LT+PVCT  GEKIALSRRVEKHWRLIGWGQI+ G T+
Sbjct:  390 KKAAKVQKLSKNEVLMVNIGSLSTGGRVSAVKADLGKIVLTNPVCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTI 465          

HSP 2 Score: 33.4982 bits (75), Expect = 1.992e-28
Identity = 15/21 (71.43%), Postives = 19/21 (90.48%), Query Frame = 3
Query:    3 NFFLLRRLLGVRTKGLRKAGK 65
            ++FLLRRLLGVRT+G +KA K
Sbjct:  374 SYFLLRRLLGVRTEGDKKAAK 394          
BLAST of BQ623117 vs. ExPASy Swiss-Prot
Match: IF2G_MOUSE (Eukaryotic translation initiation factor 2 subunit 3, X-linked OS=Mus musculus GN=Eif2s3x PE=1 SV=2)

HSP 1 Score: 112.079 bits (279), Expect = 1.992e-28
Identity = 53/76 (69.74%), Postives = 63/76 (82.89%), Query Frame = 1
Query:   52 ERQGKVSKLAKQEILMLNIGSMSTGARVLAVKNDLAKLQLTSPVCTSRGEKIALSRRVEKHWRLIGWGQIQAGTTL 279
            ++  KV KL+K E+LM+NIGS+STG RV AVK DL K+ LT+PVCT  GEKIALSRRVEKHWRLIGWGQI+ G T+
Sbjct:  390 KKAAKVQKLSKNEVLMVNIGSLSTGGRVSAVKADLGKIVLTNPVCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTI 465          

HSP 2 Score: 33.4982 bits (75), Expect = 1.992e-28
Identity = 15/21 (71.43%), Postives = 19/21 (90.48%), Query Frame = 3
Query:    3 NFFLLRRLLGVRTKGLRKAGK 65
            ++FLLRRLLGVRT+G +KA K
Sbjct:  374 SYFLLRRLLGVRTEGDKKAAK 394          
BLAST of BQ623117 vs. ExPASy Swiss-Prot
Match: IF2G_HUMAN (Eukaryotic translation initiation factor 2 subunit 3 OS=Homo sapiens GN=EIF2S3 PE=1 SV=3)

HSP 1 Score: 112.079 bits (279), Expect = 1.992e-28
Identity = 53/76 (69.74%), Postives = 63/76 (82.89%), Query Frame = 1
Query:   52 ERQGKVSKLAKQEILMLNIGSMSTGARVLAVKNDLAKLQLTSPVCTSRGEKIALSRRVEKHWRLIGWGQIQAGTTL 279
            ++  KV KL+K E+LM+NIGS+STG RV AVK DL K+ LT+PVCT  GEKIALSRRVEKHWRLIGWGQI+ G T+
Sbjct:  390 KKAAKVQKLSKNEVLMVNIGSLSTGGRVSAVKADLGKIVLTNPVCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTI 465          

HSP 2 Score: 33.4982 bits (75), Expect = 1.992e-28
Identity = 15/21 (71.43%), Postives = 19/21 (90.48%), Query Frame = 3
Query:    3 NFFLLRRLLGVRTKGLRKAGK 65
            ++FLLRRLLGVRT+G +KA K
Sbjct:  374 SYFLLRRLLGVRTEGDKKAAK 394          
BLAST of BQ623117 vs. ExPASy Swiss-Prot
Match: IF2G_CHICK (Eukaryotic translation initiation factor 2 subunit 3 OS=Gallus gallus GN=EIF2S3 PE=1 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 1.992e-28
Identity = 53/76 (69.74%), Postives = 63/76 (82.89%), Query Frame = 1
Query:   52 ERQGKVSKLAKQEILMLNIGSMSTGARVLAVKNDLAKLQLTSPVCTSRGEKIALSRRVEKHWRLIGWGQIQAGTTL 279
            ++  KV KL+K E+LM+NIGS+STG RV AVK DL K+ LT+PVCT  GEKIALSRRVEKHWRLIGWGQI+ G T+
Sbjct:  390 KKAAKVQKLSKNEVLMVNIGSLSTGGRVSAVKADLGKIVLTNPVCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTI 465          

HSP 2 Score: 33.4982 bits (75), Expect = 1.992e-28
Identity = 15/21 (71.43%), Postives = 19/21 (90.48%), Query Frame = 3
Query:    3 NFFLLRRLLGVRTKGLRKAGK 65
            ++FLLRRLLGVRT+G +KA K
Sbjct:  374 SYFLLRRLLGVRTEGDKKAAK 394          
BLAST of BQ623117 vs. ExPASy Swiss-Prot
Match: IF2G_BOVIN (Eukaryotic translation initiation factor 2 subunit 3 OS=Bos taurus GN=EIF2S3 PE=2 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 1.992e-28
Identity = 53/76 (69.74%), Postives = 63/76 (82.89%), Query Frame = 1
Query:   52 ERQGKVSKLAKQEILMLNIGSMSTGARVLAVKNDLAKLQLTSPVCTSRGEKIALSRRVEKHWRLIGWGQIQAGTTL 279
            ++  KV KL+K E+LM+NIGS+STG RV AVK DL K+ LT+PVCT  GEKIALSRRVEKHWRLIGWGQI+ G T+
Sbjct:  390 KKAAKVQKLSKNEVLMVNIGSLSTGGRVSAVKADLGKIVLTNPVCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTI 465          

HSP 2 Score: 33.4982 bits (75), Expect = 1.992e-28
Identity = 15/21 (71.43%), Postives = 19/21 (90.48%), Query Frame = 3
Query:    3 NFFLLRRLLGVRTKGLRKAGK 65
            ++FLLRRLLGVRT+G +KA K
Sbjct:  374 SYFLLRRLLGVRTEGDKKAAK 394          
BLAST of BQ623117 vs. ExPASy Swiss-Prot
Match: IF2GL_HUMAN (Eukaryotic translation initiation factor 2 subunit 3-like protein OS=Homo sapiens PE=1 SV=2)

HSP 1 Score: 112.079 bits (279), Expect = 1.992e-28
Identity = 53/76 (69.74%), Postives = 63/76 (82.89%), Query Frame = 1
Query:   52 ERQGKVSKLAKQEILMLNIGSMSTGARVLAVKNDLAKLQLTSPVCTSRGEKIALSRRVEKHWRLIGWGQIQAGTTL 279
            ++  KV KL+K E+LM+NIGS+STG RV AVK DL K+ LT+PVCT  GEKIALSRRVEKHWRLIGWGQI+ G T+
Sbjct:  390 KKAAKVQKLSKNEVLMVNIGSLSTGGRVSAVKADLGKIVLTNPVCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTI 465          

HSP 2 Score: 33.4982 bits (75), Expect = 1.992e-28
Identity = 15/21 (71.43%), Postives = 19/21 (90.48%), Query Frame = 3
Query:    3 NFFLLRRLLGVRTKGLRKAGK 65
            ++FLLRRLLGVRT+G +KA K
Sbjct:  374 SYFLLRRLLGVRTEGDKKAAK 394          
BLAST of BQ623117 vs. ExPASy Swiss-Prot
Match: IF2G_PONAB (Eukaryotic translation initiation factor 2 subunit 3 OS=Pongo abelii GN=EIF2S3 PE=2 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 7.451e-28
Identity = 52/76 (68.42%), Postives = 62/76 (81.58%), Query Frame = 1
Query:   52 ERQGKVSKLAKQEILMLNIGSMSTGARVLAVKNDLAKLQLTSPVCTSRGEKIALSRRVEKHWRLIGWGQIQAGTTL 279
            ++  KV KL+K E+LM+NIG +STG RV AVK DL K+ LT+PVCT  GEKIALSRRVEKHWRLIGWGQI+ G T+
Sbjct:  390 KKAAKVQKLSKNEVLMVNIGPLSTGGRVSAVKADLGKIVLTNPVCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTI 465          

HSP 2 Score: 33.4982 bits (75), Expect = 7.451e-28
Identity = 15/21 (71.43%), Postives = 19/21 (90.48%), Query Frame = 3
Query:    3 NFFLLRRLLGVRTKGLRKAGK 65
            ++FLLRRLLGVRT+G +KA K
Sbjct:  374 SYFLLRRLLGVRTEGDKKAAK 394          
BLAST of BQ623117 vs. ExPASy Swiss-Prot
Match: IF2G_YEAST (Eukaryotic translation initiation factor 2 subunit gamma OS=Saccharomyces cerevisiae GN=GCD11 PE=1 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 3.620e-27
Identity = 52/77 (67.53%), Postives = 63/77 (81.82%), Query Frame = 1
Query:   52 ERQGKVSKLAKQEILMLNIGSMSTGARVLAVKNDLAKLQLTSPVCTSRGEKIALSRRVEKHWRLIGWGQIQAGTTLD 282
            ++Q KV KL   E+LM+NIGS +TGARV+AVK D+A+LQLTSP CT   EKIALSRR+EKHWRLIGW  I+ GTTL+
Sbjct:  448 QKQAKVRKLEPNEVLMVNIGSTATGARVVAVKADMARLQLTSPACTEINEKIALSRRIEKHWRLIGWATIKKGTTLE 524          

HSP 2 Score: 30.8018 bits (68), Expect = 3.620e-27
Identity = 13/19 (68.42%), Postives = 17/19 (89.47%), Query Frame = 3
Query:    3 NFFLLRRLLGVRTKGLRKA 59
            N+FLLRRLLGV+T G ++A
Sbjct:  433 NYFLLRRLLGVKTDGQKQA 451          
BLAST of BQ623117 vs. ExPASy Swiss-Prot
Match: IF2G_DICDI (Eukaryotic translation initiation factor 2 subunit 3 OS=Dictyostelium discoideum GN=eif2s3 PE=2 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 6.146e-27
Identity = 52/76 (68.42%), Postives = 66/76 (86.84%), Query Frame = 1
Query:   52 ERQGKVSKLAKQEILMLNIGSMSTGARVLAVKNDLAKLQLTSPVCTSRGEKIALSRRVEKHWRLIGWGQIQAGTTL 279
            ++Q KV KL+K++ LM+NIGS STG RV+AVK+DLAKLQL +PVC+  GEKIALSRRV+K+WRLIGWG+I+ GT L
Sbjct:  383 DKQSKVKKLSKEDTLMVNIGSTSTGCRVVAVKHDLAKLQLLTPVCSQEGEKIALSRRVDKNWRLIGWGEIKKGTVL 458          

HSP 2 Score: 28.4906 bits (62), Expect = 6.146e-27
Identity = 12/15 (80.00%), Postives = 14/15 (93.33%), Query Frame = 3
Query:    3 NFFLLRRLLGVRTKG 47
            NFFLLRRLLGV++ G
Sbjct:  368 NFFLLRRLLGVKSDG 382          
The following BLAST results are available for this feature:
BLAST of BQ623117 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 16
Match NameE-valueIdentityDescription
IF2H_MOUSE1.992e-2869.74Eukaryotic translation initiation factor 2 subunit... [more]
IF2G_RAT1.992e-2869.74Eukaryotic translation initiation factor 2 subunit... [more]
IF2G_MOUSE1.992e-2869.74Eukaryotic translation initiation factor 2 subunit... [more]
IF2G_HUMAN1.992e-2869.74Eukaryotic translation initiation factor 2 subunit... [more]
IF2G_CHICK1.992e-2869.74Eukaryotic translation initiation factor 2 subunit... [more]
IF2G_BOVIN1.992e-2869.74Eukaryotic translation initiation factor 2 subunit... [more]
IF2GL_HUMAN1.992e-2869.74Eukaryotic translation initiation factor 2 subunit... [more]
IF2G_PONAB7.451e-2868.42Eukaryotic translation initiation factor 2 subunit... [more]
IF2G_YEAST3.620e-2767.53Eukaryotic translation initiation factor 2 subunit... [more]
IF2G_DICDI6.146e-2768.42Eukaryotic translation initiation factor 2 subunit... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00208 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00208 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623117 ID=BQ623117|Name=BQ623117|organism=Citrus sinensis|type=EST|length=522bp
TGAACTTCTTTCTATTGCGCCGGCTTTTGGGTGTGAGGACAAAGGGCCTC
AGAAAGGCAGGGAAAGGTCTCCAAACTTGCCAAACAAGAGATTCTTATGC
TGAACATAGGATCTATGTCGACCGGAGCTAGAGTTCTTGCTGTAAAGAAT
GATTTGGCAAAACTCCAACTTACATCTCCAGTGTGCACCAGTAGGGGGGA
GAAGATTGCGCTCAGTCGAAGAGTTGAGAAGCACTGGCGTCTTATTGGCT
GGGGCCAGATTCAAGCCGGAACTACCCTCGACGTCCCTGCCAGCCACCCA
TTACAGTAAATCGGATAAATCAGAAGCAGCAAGGAGAAACAAGTAAAACA
GGGAGAGTAGTAGCAGGGAGATGTGGGAAGGTAGGGAATTGTTGGGAACA
ATTTTTGTTAGATGGAGAAGAAAACATTGTTTGGATGATTCTATTTTGCC
TCTTTTTCCTTTTTCTTGGAAATGCCTTGAATTGATTGGAAATTTTTGTT
TGGCAGTCTCATCTATTCATGA
back to top