BQ623118

Overview
NameBQ623118
Unique NameBQ623118
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length580
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2114 contig Csv1_Contig2114:563..1141. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623118 vs. ExPASy Swiss-Prot
Match: DCE1_ARATH (Glutamate decarboxylase 1 OS=Arabidopsis thaliana GN=GAD1 PE=1 SV=2)

HSP 1 Score: 335.495 bits (859), Expect = 2.897e-93
Identity = 161/169 (95.27%), Postives = 164/169 (97.04%), Query Frame = 3
Query:   15 ICVAAILGSTLNGEFEDVKLLNDLLTEKNKETGWDTPIHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVVWRNKEDLPEELIFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGFEGYRNVMENCHENAMVLKEGLEKTGRFNIVSKDEG 521
            ICVAAILGSTLNGEFEDVKLLNDLL EKNKETGWDTPIHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWV+WRNKEDLPEELIFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLG EGYRNVMENC EN +VL+EGLEKT RFNIVSKDEG
Sbjct:  204 ICVAAILGSTLNGEFEDVKLLNDLLVEKNKETGWDTPIHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRNKEDLPEELIFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGHEGYRNVMENCRENMIVLREGLEKTERFNIVSKDEG 372          

HSP 2 Score: 26.9498 bits (58), Expect = 2.897e-93
Identity = 11/18 (61.11%), Postives = 15/18 (83.33%), Query Frame = 1
Query:  502 LCQRTKGVPLVAFSLKDN 555
            +  + +GVPLVAFSLKD+
Sbjct:  366 IVSKDEGVPLVAFSLKDS 383          
BLAST of BQ623118 vs. ExPASy Swiss-Prot
Match: DCE_PETHY (Glutamate decarboxylase OS=Petunia hybrida GN=GAD PE=1 SV=1)

HSP 1 Score: 330.102 bits (845), Expect = 3.170e-92
Identity = 156/169 (92.31%), Postives = 164/169 (97.04%), Query Frame = 3
Query:   15 ICVAAILGSTLNGEFEDVKLLNDLLTEKNKETGWDTPIHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVVWRNKEDLPEELIFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGFEGYRNVMENCHENAMVLKEGLEKTGRFNIVSKDEG 521
            ICVAAILGSTLNGEFEDVK LNDLL EKNKETGWDTPIHVDAASGGFIAPF+YPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVVWRNK+DLP+ELIFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLG+EGY+NVMENC ENA VL+EGLEKTGRFNI+SK+ G
Sbjct:  204 ICVAAILGSTLNGEFEDVKRLNDLLVEKNKETGWDTPIHVDAASGGFIAPFIYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVVWRNKDDLPDELIFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGYEGYKNVMENCQENASVLREGLEKTGRFNIISKEIG 372          

HSP 2 Score: 28.8758 bits (63), Expect = 3.170e-92
Identity = 12/14 (85.71%), Postives = 14/14 (100.00%), Query Frame = 1
Query:  520 GVPLVAFSLKDNKR 561
            GVPLVAFSLKDN++
Sbjct:  372 GVPLVAFSLKDNRQ 385          
BLAST of BQ623118 vs. ExPASy Swiss-Prot
Match: DCE2_ARATH (Glutamate decarboxylase 2 OS=Arabidopsis thaliana GN=GAD2 PE=1 SV=1)

HSP 1 Score: 321.627 bits (823), Expect = 1.691e-87
Identity = 153/169 (90.53%), Postives = 162/169 (95.86%), Query Frame = 3
Query:   15 ICVAAILGSTLNGEFEDVKLLNDLLTEKNKETGWDTPIHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVVWRNKEDLPEELIFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGFEGYRNVMENCHENAMVLKEGLEKTGRFNIVSKDEG 521
            ICVAAILGSTLNGEFEDVK LNDLL +KN+ETGW+TPIHVDAASGGFIAPF+YPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVVWR  EDLPEELIFHINYLGADQPTFTLNFSKGSSQ+IAQYYQLIRLGFEGY+NVMENC EN +VLKEG+EKT RFNIVSKD+G
Sbjct:  203 ICVAAILGSTLNGEFEDVKRLNDLLVKKNEETGWNTPIHVDAASGGFIAPFIYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVVWRAAEDLPEELIFHINYLGADQPTFTLNFSKGSSQIIAQYYQLIRLGFEGYKNVMENCIENMVVLKEGIEKTERFNIVSKDQG 371          
BLAST of BQ623118 vs. ExPASy Swiss-Prot
Match: DCE_SOLLC (Glutamate decarboxylase OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 309.686 bits (792), Expect = 1.010e-84
Identity = 144/169 (85.21%), Postives = 160/169 (94.67%), Query Frame = 3
Query:   15 ICVAAILGSTLNGEFEDVKLLNDLLTEKNKETGWDTPIHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVVWRNKEDLPEELIFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGFEGYRNVMENCHENAMVLKEGLEKTGRFNIVSKDEG 521
            ICVAAILGSTL GEFEDVKLLN+LLT+KNKETGW+TPIHVDAASGGFIAPFL+P+LEWDFRLPLVKSINVSGHKYGLVYAG+GWV+WR+KEDLP+EL+FHINYLG+DQPTFTLNFSKGS Q+IAQYYQLIRLGFEGY+NVM+NC  NA VL EG+ K GRF+IVSKD G
Sbjct:  205 ICVAAILGSTLTGEFEDVKLLNELLTKKNKETGWETPIHVDAASGGFIAPFLWPDLEWDFRLPLVKSINVSGHKYGLVYAGVGWVIWRSKEDLPDELVFHINYLGSDQPTFTLNFSKGSYQIIAQYYQLIRLGFEGYKNVMKNCLSNAKVLTEGITKMGRFDIVSKDVG 373          

HSP 2 Score: 24.2534 bits (51), Expect = 1.010e-84
Identity = 9/14 (64.29%), Postives = 13/14 (92.86%), Query Frame = 1
Query:  520 GVPLVAFSLKDNKR 561
            GVP+VAFSL+D+ +
Sbjct:  373 GVPVVAFSLRDSSK 386          
BLAST of BQ623118 vs. ExPASy Swiss-Prot
Match: DCE_LACLM (Glutamate decarboxylase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=gadB PE=1 SV=2)

HSP 1 Score: 200.675 bits (509), Expect = 4.351e-51
Identity = 93/165 (56.36%), Postives = 121/165 (73.33%), Query Frame = 3
Query:   15 ICVAAILGSTLNGEFEDVKLLNDLLTEKNKETGWDTPIHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVVWRNKEDLPEELIFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGFEGYRNVMENCHENAMVLKEGLEKTGRFNIVS 509
            I V  I+G T  G ++D+K L++L+ E NK+T +   IHVDAASGG  APF+ PELEWDFRL  V SIN SGHKYGLVY G+GWV+WR+K+ LPEELIF ++YLG + PT  +NFS  +SQ+I QYY  +R GF+GY+ + E  H+ AM L E +EKTG F I++
Sbjct:  204 IGVVGIMGITYTGRYDDIKALDNLIEEYNKQTDYKVYIHVDAASGGLYAPFVEPELEWDFRLKNVISINTSGHKYGLVYPGVGWVLWRDKKYLPEELIFKVSYLGGELPTMAINFSHSASQLIGQYYNFVRYGFDGYKAIHERTHKVAMYLAEEIEKTGMFEIMN 368          
BLAST of BQ623118 vs. ExPASy Swiss-Prot
Match: DCE_LACLA (Glutamate decarboxylase OS=Lactococcus lactis subsp. lactis GN=gadB PE=1 SV=1)

HSP 1 Score: 199.134 bits (505), Expect = 1.266e-50
Identity = 92/165 (55.76%), Postives = 121/165 (73.33%), Query Frame = 3
Query:   15 ICVAAILGSTLNGEFEDVKLLNDLLTEKNKETGWDTPIHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVVWRNKEDLPEELIFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGFEGYRNVMENCHENAMVLKEGLEKTGRFNIVS 509
            I V  I+G T  G ++D+K L++L+ E NK+T +   IHVDAASGG  APF+ PELEWDFRL  V SIN SGHKYGLVY G+GWV+WR+K+ LPEELIF ++YLG + PT  +NFS  +SQ+I QYY  +R GF+GY+ + E  H+ AM L + +EKTG F I++
Sbjct:  204 IGVVGIMGITYTGRYDDIKALDNLIEEYNKQTDYKVYIHVDAASGGLYAPFVEPELEWDFRLKNVISINTSGHKYGLVYPGVGWVLWRDKKYLPEELIFKVSYLGGELPTMAINFSHSASQLIGQYYNFVRYGFDGYKAIHERTHKVAMFLAKEIEKTGMFEIMN 368          
BLAST of BQ623118 vs. ExPASy Swiss-Prot
Match: GADA_DICDI (Glutamate decarboxylase A OS=Dictyostelium discoideum GN=gadA PE=2 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 1.892e-46
Identity = 88/173 (50.87%), Postives = 118/173 (68.21%), Query Frame = 3
Query:   15 ICVAAILGSTLNGEFEDVKLLNDLLTEKNKETGWDTPIHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVVWRNKEDLPEELIFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGFEGYRNVMENCHENAMVLKEGLEKTGRFNIVSKDEGGSVG 533
            I V   LG T   ++EDVK +++ L +  KETG D PIHVDAASGGF+APFL PE+ WDFRLP VKSIN SGHK+GL   G+GWVVWR K D+ ++L+F +NYLG + PTF+LNFS+   Q++ QYY  +R G  GY  V + C ++ + + + ++K G F+IV    G   G
Sbjct:  201 IGVIPTLGVTFTLQYEDVKGISEALDKFEKETGLDIPIHVDAASGGFVAPFLQPEIVWDFRLPRVKSINGSGHKFGLSPLGVGWVVWRGKNDIHKDLVFDVNYLGGNMPTFSLNFSRPGGQIVCQYYNFLRHGRSGYTAVHQACLDHGIFISKQVKKHGIFDIVYDGTGALPG 373          
BLAST of BQ623118 vs. ExPASy Swiss-Prot
Match: DCEA_LISMO (Glutamate decarboxylase alpha OS=Listeria monocytogenes GN=gadA PE=3 SV=2)

HSP 1 Score: 184.882 bits (468), Expect = 2.471e-46
Identity = 83/163 (50.92%), Postives = 110/163 (67.48%), Query Frame = 3
Query:   15 ICVAAILGSTLNGEFEDVKLLNDLLTEKNKETGWDTPIHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVVWRNKEDLPEELIFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGFEGYRNVMENCHENAMVLKEGLEKTGRFNI 503
            I +  ILG T  G+F+D+  LNDL+ + N     +  IHVD ASG    PF+ P LEWDFRLP V SIN SGHKYGLVY G+GW++WR+KE LPEEL+F ++YLG   PT  +NFS+ +SQ+I QYY  +R G+EGYR +     + A+ L + + +TG F I
Sbjct:  200 IGIVGILGITYTGKFDDIMTLNDLVEDYNNTHDNEVVIHVDGASGAMFTPFVEPGLEWDFRLPNVVSINTSGHKYGLVYPGVGWILWRDKEYLPEELVFDVSYLGGHMPTMAINFSRSASQIIGQYYNFLRFGYEGYRQIHMRTRDGALQLSQAVAETGLFEI 362          
BLAST of BQ623118 vs. ExPASy Swiss-Prot
Match: DCEB_LISMO (Glutamate decarboxylase beta OS=Listeria monocytogenes GN=gadB PE=3 SV=2)

HSP 1 Score: 183.726 bits (465), Expect = 5.504e-46
Identity = 85/163 (52.15%), Postives = 112/163 (68.71%), Query Frame = 3
Query:   15 ICVAAILGSTLNGEFEDVKLLNDLLTEKNKETGWDTPIHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVVWRNKEDLPEELIFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGFEGYRNVMENCHENAMVLKEGLEKTGRFNI 503
            I V  ILG T  G ++D+  LN+ L E N +T +   IHVDAASGGF  PF+ P++ WDFRL  V SIN SGHKYGLVY GIGWV+W+++  LPEELIF ++YLG + PT  +NFS+ +S +I QYY  +R GFEGYR + +   + A  L   +E+TG F+I
Sbjct:  202 IGVVGILGITYTGRYDDIYALNEKLEEYNSKTDYKVYIHVDAASGGFFTPFVEPDIIWDFRLKNVISINTSGHKYGLVYPGIGWVLWKDESYLPEELIFKVSYLGGEMPTMQINFSRSASHIIGQYYNFLRYGFEGYRTIHQKTSDVAQYLAHAVEQTGYFDI 364          
BLAST of BQ623118 vs. ExPASy Swiss-Prot
Match: DCEB_LISIN (Glutamate decarboxylase beta OS=Listeria innocua GN=gadB PE=3 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 5.504e-46
Identity = 85/163 (52.15%), Postives = 112/163 (68.71%), Query Frame = 3
Query:   15 ICVAAILGSTLNGEFEDVKLLNDLLTEKNKETGWDTPIHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVVWRNKEDLPEELIFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGFEGYRNVMENCHENAMVLKEGLEKTGRFNI 503
            I V  ILG T  G ++D+  LN+ L E N +T +   IHVDAASGGF  PF+ P++ WDFRL  V SIN SGHKYGLVY GIGWV+W+++  LPEELIF ++YLG + PT  +NFS+ +S +I QYY  +R GFEGYR + +   + A  L   +E+TG F+I
Sbjct:  202 IGVVGILGITYTGRYDDIYALNEKLEEYNSKTDYKVYIHVDAASGGFFTPFVEPDIIWDFRLKNVISINTSGHKYGLVYPGIGWVLWKDESYLPEELIFKVSYLGGEMPTMQINFSRSASHIIGQYYNFLRYGFEGYRTIHQKTSDVAQYLAHAVEQTGYFDI 364          
The following BLAST results are available for this feature:
BLAST of BQ623118 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 38
Match NameE-valueIdentityDescription
DCE1_ARATH2.897e-9395.27Glutamate decarboxylase 1 OS=Arabidopsis thaliana ... [more]
DCE_PETHY3.170e-9292.31Glutamate decarboxylase OS=Petunia hybrida GN=GAD ... [more]
DCE2_ARATH1.691e-8790.53Glutamate decarboxylase 2 OS=Arabidopsis thaliana ... [more]
DCE_SOLLC1.010e-8485.21Glutamate decarboxylase OS=Solanum lycopersicum PE... [more]
DCE_LACLM4.351e-5156.36Glutamate decarboxylase OS=Lactococcus lactis subs... [more]
DCE_LACLA1.266e-5055.76Glutamate decarboxylase OS=Lactococcus lactis subs... [more]
GADA_DICDI1.892e-4650.87Glutamate decarboxylase A OS=Dictyostelium discoid... [more]
DCEA_LISMO2.471e-4650.92Glutamate decarboxylase alpha OS=Listeria monocyto... [more]
DCEB_LISMO5.504e-4652.15Glutamate decarboxylase beta OS=Listeria monocytog... [more]
DCEB_LISIN5.504e-4652.15Glutamate decarboxylase beta OS=Listeria innocua G... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00209 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00209 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623118 ID=BQ623118|Name=BQ623118|organism=Citrus sinensis|type=EST|length=580bp
GGATGAAAACACCTATCTGTGTTGCTGCTATTCTGGGTTCTACTCTCAAT
GGAGAATTTGAAGATGTCAAGCTCTTGAACGACCTTTTGACAGAGAAGAA
CAAGGAAACAGGATGGGATACTCCAATTCATGTTGATGCTGCTAGTGGTG
GCTTCATTGCACCATTTTTGTACCCAGAGCTTGAATGGGACTTCCGCTTG
CCGCTGGTGAAGAGTATTAATGTTAGTGGCCACAAGTACGGGCTTGTGTA
TGCTGGTATTGGTTGGGTTGTTTGGAGAAACAAAGAAGACTTGCCTGAAG
AACTCATCTTCCACATCAATTACCTAGGAGCTGATCAACCCACCTTCACC
CTCAATTTTTCTAAAGGTTCTAGCCAAGTAATTGCTCAGTACTACCAACT
AATCCGCTTAGGTTTTGAGGGATACCGCAATGTGATGGAGAATTGTCACG
AAAATGCAATGGTGCTGAAAGAAGGACTAGAGAAAACCGGCCGCTTCAAC
ATTGTGTCAAAGGACGAAGGGGGTTCCGTTGGTGGCATTTTCTCTCAAGG
ACAACAAACGCGCACGATGAATTCGAAGTG
back to top