BQ623128

Overview
NameBQ623128
Unique NameBQ623128
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length513
Libraries
Library NameType
Ridge pineapple sweet orange entire seedlingcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
BQ623128_ssr469 microsatellite BQ623128_ssr469:469..483. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig7528 contig Csv1_Contig7528:832..1344. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of BQ623128 vs. ExPASy Swiss-Prot
Match: PIP25_ARATH (Probable aquaporin PIP2-5 OS=Arabidopsis thaliana GN=PIP2-5 PE=1 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 1.376e-20
Identity = 43/50 (86.00%), Postives = 47/50 (94.00%), Query Frame = 1
Query:   10 ARSLGAAVIYNKDKAWDDQWLFWVGPFIGAAIAAFYHQFILRAGAVKALG 159
            ARSLGAA+IYNKDKAWD  W+FWVGPF GAAIAAFYHQF+LRAGA+KALG
Sbjct:  229 ARSLGAAIIYNKDKAWDHHWIFWVGPFAGAAIAAFYHQFVLRAGAIKALG 278          
BLAST of BQ623128 vs. ExPASy Swiss-Prot
Match: PIP21_MAIZE (Aquaporin PIP2-1 OS=Zea mays GN=PIP2-1 PE=1 SV=2)

HSP 1 Score: 98.5969 bits (244), Expect = 1.797e-20
Identity = 43/50 (86.00%), Postives = 47/50 (94.00%), Query Frame = 1
Query:   10 ARSLGAAVIYNKDKAWDDQWLFWVGPFIGAAIAAFYHQFILRAGAVKALG 159
            ARSLGAAVIYNKDK WDD W+FWVGP +GAAIAAFYHQ+ILRAGA+KALG
Sbjct:  235 ARSLGAAVIYNKDKPWDDHWIFWVGPLVGAAIAAFYHQYILRAGAIKALG 284          
BLAST of BQ623128 vs. ExPASy Swiss-Prot
Match: PIP22_MAIZE (Aquaporin PIP2-2 OS=Zea mays GN=PIP2-2 PE=2 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 3.066e-20
Identity = 42/50 (84.00%), Postives = 47/50 (94.00%), Query Frame = 1
Query:   10 ARSLGAAVIYNKDKAWDDQWLFWVGPFIGAAIAAFYHQFILRAGAVKALG 159
            ARSLGAAV+YNKDK WDD W+FWVGP +GAAIAAFYHQ+ILRAGA+KALG
Sbjct:  237 ARSLGAAVVYNKDKPWDDHWIFWVGPLLGAAIAAFYHQYILRAGAIKALG 286          
BLAST of BQ623128 vs. ExPASy Swiss-Prot
Match: PIP26_ARATH (Probable aquaporin PIP2-6 OS=Arabidopsis thaliana GN=PIP2-6 PE=1 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 5.229e-20
Identity = 42/50 (84.00%), Postives = 46/50 (92.00%), Query Frame = 1
Query:   10 ARSLGAAVIYNKDKAWDDQWLFWVGPFIGAAIAAFYHQFILRAGAVKALG 159
            ARS GAAVIYN  KAWDDQW+FWVGPF+GAAIAAFYHQF+LRAGA+KA G
Sbjct:  229 ARSFGAAVIYNNQKAWDDQWIFWVGPFVGAAIAAFYHQFVLRAGAMKAYG 278          
BLAST of BQ623128 vs. ExPASy Swiss-Prot
Match: PIP24_ARATH (Probable aquaporin PIP2-4 OS=Arabidopsis thaliana GN=PIP2-4 PE=1 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 2.595e-19
Identity = 42/50 (84.00%), Postives = 45/50 (90.00%), Query Frame = 1
Query:   10 ARSLGAAVIYNKDKAWDDQWLFWVGPFIGAAIAAFYHQFILRAGAVKALG 159
            ARS GAAVIYN +KAWDDQW+FWVGP IGAA AAFYHQFILRA A+KALG
Sbjct:  230 ARSFGAAVIYNNEKAWDDQWIFWVGPMIGAAAAAFYHQFILRAAAIKALG 279          
BLAST of BQ623128 vs. ExPASy Swiss-Prot
Match: PIP21_ORYSJ (Probable aquaporin PIP2-1 OS=Oryza sativa subsp. japonica GN=PIP2-1 PE=2 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 1.288e-18
Identity = 39/50 (78.00%), Postives = 47/50 (94.00%), Query Frame = 1
Query:   10 ARSLGAAVIYNKDKAWDDQWLFWVGPFIGAAIAAFYHQFILRAGAVKALG 159
            ARS+GAAVI+N +KAW + W+FWVGPF+GAAIAAFYHQ+ILRAGA+KALG
Sbjct:  235 ARSIGAAVIFNNEKAWHNHWIFWVGPFVGAAIAAFYHQYILRAGAIKALG 284          
BLAST of BQ623128 vs. ExPASy Swiss-Prot
Match: PIP22_ARATH (Aquaporin PIP2-2 OS=Arabidopsis thaliana GN=PIP2-2 PE=1 SV=2)

HSP 1 Score: 91.2781 bits (225), Expect = 2.869e-18
Identity = 40/50 (80.00%), Postives = 43/50 (86.00%), Query Frame = 1
Query:   10 ARSLGAAVIYNKDKAWDDQWLFWVGPFIGAAIAAFYHQFILRAGAVKALG 159
            ARS GAAVIYNK K WDD W+FWVGPFIGAAIAAFYHQF+LRA   K+LG
Sbjct:  228 ARSFGAAVIYNKSKPWDDHWIFWVGPFIGAAIAAFYHQFVLRASGSKSLG 277          
BLAST of BQ623128 vs. ExPASy Swiss-Prot
Match: PIP21_ARATH (Aquaporin PIP2-1 OS=Arabidopsis thaliana GN=PIP2-1 PE=1 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 2.869e-18
Identity = 40/50 (80.00%), Postives = 43/50 (86.00%), Query Frame = 1
Query:   10 ARSLGAAVIYNKDKAWDDQWLFWVGPFIGAAIAAFYHQFILRAGAVKALG 159
            ARS GAAVIYNK K WDD W+FWVGPFIGAAIAAFYHQF+LRA   K+LG
Sbjct:  230 ARSFGAAVIYNKSKPWDDHWIFWVGPFIGAAIAAFYHQFVLRASGSKSLG 279          
BLAST of BQ623128 vs. ExPASy Swiss-Prot
Match: PIP24_MAIZE (Aquaporin PIP2-4 OS=Zea mays GN=PIP2-4 PE=1 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 4.894e-18
Identity = 40/47 (85.11%), Postives = 43/47 (91.49%), Query Frame = 1
Query:   10 ARSLGAAVIYNKDKAWDDQWLFWVGPFIGAAIAAFYHQFILRAGAVK 150
            ARSLGAAVIYNKDKAWDDQW+FWVGP IGAAIAA YHQ++LRA A K
Sbjct:  234 ARSLGAAVIYNKDKAWDDQWIFWVGPLIGAAIAAAYHQYVLRASATK 280          
BLAST of BQ623128 vs. ExPASy Swiss-Prot
Match: PIP23_MAIZE (Aquaporin PIP2-3 OS=Zea mays GN=PIP2-3 PE=2 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 4.894e-18
Identity = 40/47 (85.11%), Postives = 43/47 (91.49%), Query Frame = 1
Query:   10 ARSLGAAVIYNKDKAWDDQWLFWVGPFIGAAIAAFYHQFILRAGAVK 150
            ARSLGAAVIYNKDKAWDDQW+FWVGP IGAAIAA YHQ++LRA A K
Sbjct:  235 ARSLGAAVIYNKDKAWDDQWIFWVGPLIGAAIAAAYHQYVLRASATK 281          
The following BLAST results are available for this feature:
BLAST of BQ623128 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 39
Match NameE-valueIdentityDescription
PIP25_ARATH1.376e-2086.00Probable aquaporin PIP2-5 OS=Arabidopsis thaliana ... [more]
PIP21_MAIZE1.797e-2086.00Aquaporin PIP2-1 OS=Zea mays GN=PIP2-1 PE=1 SV=2[more]
PIP22_MAIZE3.066e-2084.00Aquaporin PIP2-2 OS=Zea mays GN=PIP2-2 PE=2 SV=1[more]
PIP26_ARATH5.229e-2084.00Probable aquaporin PIP2-6 OS=Arabidopsis thaliana ... [more]
PIP24_ARATH2.595e-1984.00Probable aquaporin PIP2-4 OS=Arabidopsis thaliana ... [more]
PIP21_ORYSJ1.288e-1878.00Probable aquaporin PIP2-1 OS=Oryza sativa subsp. j... [more]
PIP22_ARATH2.869e-1880.00Aquaporin PIP2-2 OS=Arabidopsis thaliana GN=PIP2-2... [more]
PIP21_ARATH2.869e-1880.00Aquaporin PIP2-1 OS=Arabidopsis thaliana GN=PIP2-1... [more]
PIP24_MAIZE4.894e-1885.11Aquaporin PIP2-4 OS=Zea mays GN=PIP2-4 PE=1 SV=1[more]
PIP23_MAIZE4.894e-1885.11Aquaporin PIP2-3 OS=Zea mays GN=PIP2-3 PE=2 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_00219 Ridge pineapple sweet orange entire seedling Citrus sinensis cDNA clone USDA-FP_00219 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>BQ623128 ID=BQ623128|Name=BQ623128|organism=Citrus sinensis|type=EST|length=513bp
CGGCAGAGAGCAAGGAGTCTCGGGGCCGCTGTTATTTACAACAAGGACAA
GGCTTGGGATGATCAATGGCTCTTCTGGGTTGGACCCTTCATCGGTGCAG
CAATTGCGGCTTTCTACCACCAATTCATCTTGAGAGCTGGAGCTGTCAAG
GCTCTTGGTTCATTCAGGAGCCAATCCCGTGTCTGATTTTAGTTTCGACA
AGTGGATTATCCACATCTTCATGGGGTTAATGATTTAAAATTGGAAAGAA
AAAACTGGGAAGGAGTAGAGGTGTGTTAAGTTTCAAAAAGTGAATAATGA
GGGGGGGTGTGATTTGTGCTTTCAAGGAGTTGTAGGCAAAAAGTCTCTTA
GACAATGAGGGGGCTTGCTTTTTTGTAATCCCCTCTGTTGTTTTCAAGCA
CTTTCCTTAGAATTCACTTCTTCAATGTTTCTGTCTCTTTCTACTTTGTA
TTATTTTCTCCGTATGTGATTATTATTATTATTGTTGTGCTTTAAGGAAA
AAAAAAAAATTAT
back to top