BQ623930
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of BQ623930 vs. ExPASy Swiss-Prot
Match: DNJH_CUCSA (DnaJ protein homolog OS=Cucumis sativus GN=DNAJ1 PE=2 SV=1) HSP 1 Score: 87.8113 bits (216), Expect = 1.867e-17 Identity = 41/46 (89.13%), Postives = 44/46 (95.65%), Query Frame = 3 Query: 3 LSPDQCKMLETVLPPRTSVQLTDMELDECEETTLHDVNIEEEMRRK 140 L+P+QCK LE VLPPRTSVQL+DMELDECEETTLHDVNIEEEMRRK Sbjct: 344 LNPEQCKALEGVLPPRTSVQLSDMELDECEETTLHDVNIEEEMRRK 389
BLAST of BQ623930 vs. ExPASy Swiss-Prot
Match: DNJH2_ALLPO (DnaJ protein homolog 2 OS=Allium porrum GN=LDJ2 PE=2 SV=1) HSP 1 Score: 80.4925 bits (197), Expect = 2.980e-15 Identity = 36/46 (78.26%), Postives = 42/46 (91.30%), Query Frame = 3 Query: 3 LSPDQCKMLETVLPPRTSVQLTDMELDECEETTLHDVNIEEEMRRK 140 L+PDQCK LE+VLP R + +LTDME+DECEETT+HDVNIEEEMRRK Sbjct: 346 LTPDQCKALESVLPSRNASRLTDMEIDECEETTMHDVNIEEEMRRK 391
BLAST of BQ623930 vs. ExPASy Swiss-Prot
Match: DNJH1_ALLPO (DnaJ protein homolog 1 (Fragment) OS=Allium porrum GN=DNAJ1 PE=2 SV=1) HSP 1 Score: 80.4925 bits (197), Expect = 2.980e-15 Identity = 36/46 (78.26%), Postives = 42/46 (91.30%), Query Frame = 3 Query: 3 LSPDQCKMLETVLPPRTSVQLTDMELDECEETTLHDVNIEEEMRRK 140 L+PDQCK++E+VLP S QLTDME+DECEETT+HDVNIEEEMRRK Sbjct: 325 LTPDQCKVIESVLPRSASSQLTDMEIDECEETTMHDVNIEEEMRRK 370
BLAST of BQ623930 vs. ExPASy Swiss-Prot
Match: DNAJ3_ARATH (Chaperone protein dnaJ 3 OS=Arabidopsis thaliana GN=ATJ3 PE=1 SV=2) HSP 1 Score: 75.485 bits (184), Expect = 9.586e-14 Identity = 35/46 (76.09%), Postives = 40/46 (86.96%), Query Frame = 3 Query: 3 LSPDQCKMLETVLPPRTSVQLTDMELDECEETTLHDVNIEEEMRRK 140 LSPDQ K LE VLP ++ QL+DME+DECEETTLHDVNIE+EMRRK Sbjct: 346 LSPDQTKALEAVLPKPSTAQLSDMEIDECEETTLHDVNIEDEMRRK 391
BLAST of BQ623930 vs. ExPASy Swiss-Prot
Match: DNJH_ATRNU (DnaJ protein homolog ANJ1 OS=Atriplex nummularia PE=2 SV=1) HSP 1 Score: 74.3294 bits (181), Expect = 2.136e-13 Identity = 34/46 (73.91%), Postives = 40/46 (86.96%), Query Frame = 3 Query: 3 LSPDQCKMLETVLPPRTSVQLTDMELDECEETTLHDVNIEEEMRRK 140 L+PDQ K LE +LPP+ S+ LT MELDECEETTLH+VNIEEEM+RK Sbjct: 346 LNPDQVKSLEAILPPKPSMSLTYMELDECEETTLHNVNIEEEMKRK 391
BLAST of BQ623930 vs. ExPASy Swiss-Prot
Match: DNAJ2_ARATH (Chaperone protein dnaJ 2 OS=Arabidopsis thaliana GN=ATJ2 PE=1 SV=2) HSP 1 Score: 70.4774 bits (171), Expect = 3.084e-12 Identity = 31/46 (67.39%), Postives = 38/46 (82.61%), Query Frame = 3 Query: 3 LSPDQCKMLETVLPPRTSVQLTDMELDECEETTLHDVNIEEEMRRK 140 LSPDQ K +E VLP T ++DME+D+CEETTLHDVNIE+EM+RK Sbjct: 347 LSPDQTKAIEAVLPKPTKAAISDMEIDDCEETTLHDVNIEDEMKRK 392 The following BLAST results are available for this feature:
BLAST of BQ623930 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 6
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >BQ623930 ID=BQ623930; Name=BQ623930; organism=Citrus sinensis; type=EST; length=325bpback to top |