CB290652
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CB290652 vs. ExPASy Swiss-Prot
Match: LTI6B_ORYSJ (Hydrophobic protein LTI6B OS=Oryza sativa subsp. japonica GN=LTI6B PE=2 SV=1) HSP 1 Score: 98.9821 bits (245), Expect = 1.614e-20 Identity = 44/52 (84.62%), Postives = 48/52 (92.31%), Query Frame = 2 Query: 98 TATCVDILLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 253 TA C+DIL+A+ILPPLGVFLKFGC EFWICLLLT LGYIPGIIYA+YAITK Sbjct: 4 TANCIDILIAIILPPLGVFLKFGCGHEFWICLLLTFLGYIPGIIYAIYAITK 55
BLAST of CB290652 vs. ExPASy Swiss-Prot
Match: LTI6B_ORYSI (Hydrophobic protein LTI6B OS=Oryza sativa subsp. indica GN=LTI6B PE=3 SV=2) HSP 1 Score: 98.9821 bits (245), Expect = 1.614e-20 Identity = 44/52 (84.62%), Postives = 48/52 (92.31%), Query Frame = 2 Query: 98 TATCVDILLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 253 TA C+DIL+A+ILPPLGVFLKFGC EFWICLLLT LGYIPGIIYA+YAITK Sbjct: 4 TANCIDILIAIILPPLGVFLKFGCGHEFWICLLLTFLGYIPGIIYAIYAITK 55
BLAST of CB290652 vs. ExPASy Swiss-Prot
Match: LTI6A_ORYSJ (Hydrophobic protein LTI6A OS=Oryza sativa subsp. japonica GN=LTI6A PE=2 SV=1) HSP 1 Score: 97.0561 bits (240), Expect = 6.132e-20 Identity = 45/57 (78.95%), Postives = 50/57 (87.72%), Query Frame = 2 Query: 83 MADGSTATCVDILLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 253 MAD STATC+DI+LA+ILPPLGVF KFGC EFWICLLLT GY+PGIIYAV+ ITK Sbjct: 1 MAD-STATCIDIILAIILPPLGVFFKFGCGIEFWICLLLTFFGYLPGIIYAVWVITK 56
BLAST of CB290652 vs. ExPASy Swiss-Prot
Match: RCI2B_ARATH (Hydrophobic protein RCI2B OS=Arabidopsis thaliana GN=RCI2B PE=2 SV=1) HSP 1 Score: 94.7449 bits (234), Expect = 3.043e-19 Identity = 41/53 (77.36%), Postives = 49/53 (92.45%), Query Frame = 2 Query: 95 STATCVDILLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 253 STAT V+I+LA+ILPPLGVFLKFGCK EFWICL+LT+ GY+PGI+YA+Y ITK Sbjct: 2 STATFVEIILAIILPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALYIITK 54
BLAST of CB290652 vs. ExPASy Swiss-Prot
Match: RCI2A_ARATH (Hydrophobic protein RCI2A OS=Arabidopsis thaliana GN=RCI2A PE=2 SV=1) HSP 1 Score: 93.9745 bits (232), Expect = 5.191e-19 Identity = 40/53 (75.47%), Postives = 49/53 (92.45%), Query Frame = 2 Query: 95 STATCVDILLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 253 STAT VDI++A++LPPLGVFL+FGC EFWICL+LT+LGYIPGIIYA+Y +TK Sbjct: 2 STATFVDIIIAILLPPLGVFLRFGCGVEFWICLVLTLLGYIPGIIYAIYVLTK 54
BLAST of CB290652 vs. ExPASy Swiss-Prot
Match: OSR8_ORYSJ (Hydrophobic protein OSR8 OS=Oryza sativa subsp. japonica GN=OSR8 PE=3 SV=1) HSP 1 Score: 82.4185 bits (202), Expect = 1.563e-15 Identity = 40/56 (71.43%), Postives = 46/56 (82.14%), Query Frame = 2 Query: 83 MADGSTATCVDILLAVILPPLGVFLKFGC-KAEFWICLLLTILGYIPGIIYAVYAI 247 MA G T ++ILLA+ILPPLGVFL+FGC EF ICLLLTILGY+PGIIYAVY + Sbjct: 1 MASGRCCTFLEILLAIILPPLGVFLRFGCCSMEFCICLLLTILGYVPGIIYAVYVL 56
BLAST of CB290652 vs. ExPASy Swiss-Prot
Match: LT02_HORVU (Low temperature-induced protein lt101.2 OS=Hordeum vulgare GN=LT101.2 PE=2 SV=1) HSP 1 Score: 82.4185 bits (202), Expect = 1.563e-15 Identity = 34/51 (66.67%), Postives = 46/51 (90.20%), Query Frame = 2 Query: 95 STATCVDILLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAI 247 ++AT ++++LA+ILPP+GVFL++G EFWICLLLT+LGYIPGIIYAVY + Sbjct: 2 ASATFIEVILAIILPPVGVFLRYGLAVEFWICLLLTLLGYIPGIIYAVYVL 52
BLAST of CB290652 vs. ExPASy Swiss-Prot
Match: LT01_HORVU (Low temperature-induced protein lt101.1 OS=Hordeum vulgare GN=LT101.1 PE=2 SV=1) HSP 1 Score: 78.9518 bits (193), Expect = 1.728e-14 Identity = 34/50 (68.00%), Postives = 44/50 (88.00%), Query Frame = 2 Query: 98 TATCVDILLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAI 247 +AT ++++LA+ILPP+GVFL++ EFWICLLLTILGYIPGIIYAVY + Sbjct: 3 SATVLEVILAIILPPVGVFLRYKLGVEFWICLLLTILGYIPGIIYAVYVL 52
BLAST of CB290652 vs. ExPASy Swiss-Prot
Match: ESI3_LOPEL (Salt stress-induced hydrophobic peptide ESI3 OS=Lophopyrum elongatum GN=ESI3 PE=2 SV=1) HSP 1 Score: 78.9518 bits (193), Expect = 1.728e-14 Identity = 34/50 (68.00%), Postives = 44/50 (88.00%), Query Frame = 2 Query: 98 TATCVDILLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAI 247 +AT ++++LA+ILPP+GVFL++ EFWICLLLTILGYIPGIIYAVY + Sbjct: 3 SATVLEVILAIILPPVGVFLRYKLGVEFWICLLLTILGYIPGIIYAVYVL 52
BLAST of CB290652 vs. ExPASy Swiss-Prot
Match: PMP3_DEBHA (Plasma membrane proteolipid 3 OS=Debaryomyces hansenii GN=PMP3 PE=3 SV=1) HSP 1 Score: 72.4034 bits (176), Expect = 1.617e-12 Identity = 34/53 (64.15%), Postives = 43/53 (81.13%), Query Frame = 2 Query: 104 TCVDI---LLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 253 TC DI ++A+ILPPLGVFL+ GC + FWI ++LTILGYIPGII+A+Y I K Sbjct: 4 TCSDIFKIIIAIILPPLGVFLERGCASSFWINIVLTILGYIPGIIHALYVILK 56 The following BLAST results are available for this feature:
BLAST of CB290652 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 18
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CB290652 ID=CB290652; Name=CB290652; organism=Citrus sinensis; type=EST; length=552bpback to top |