CB304385

Overview
NameCB304385
Unique NameCB304385
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length625
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4200 contig Csv1_Contig4200:339..963. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB304385 vs. ExPASy Swiss-Prot
Match: R10A1_ARATH (60S ribosomal protein L10a-1 OS=Arabidopsis thaliana GN=RPL10AA PE=2 SV=1)

HSP 1 Score: 209.149 bits (531), Expect = 1.429e-53
Identity = 106/111 (95.50%), Postives = 107/111 (96.40%), Query Frame = -3
Query:  231 YHAFLASESVIKQIPRLLGPGLNKAGKFPTLVTHQESLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIFQNVQMSVNFLVSLLKKNXXNVRCLYLKSTMGPSSRIF 563
            YHAFLASESVIKQIPRLLGPGLNKAGKFPTLV+HQESLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIFQNVQMSVNFLVSLLKKN  NVRCLYLKSTMGP  RIF
Sbjct:  106 YHAFLASESVIKQIPRLLGPGLNKAGKFPTLVSHQESLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIFQNVQMSVNFLVSLLKKNWQNVRCLYLKSTMGPPQRIF 216          
BLAST of CB304385 vs. ExPASy Swiss-Prot
Match: R10A3_ARATH (60S ribosomal protein L10a-3 OS=Arabidopsis thaliana GN=RPL10AC PE=2 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 4.157e-53
Identity = 104/111 (93.69%), Postives = 108/111 (97.30%), Query Frame = -3
Query:  231 YHAFLASESVIKQIPRLLGPGLNKAGKFPTLVTHQESLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIFQNVQMSVNFLVSLLKKNXXNVRCLYLKSTMGPSSRIF 563
            +HAFLASESVIKQIPRLLGPGLNKAGKFPTLV+HQESLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIFQNVQMSVNFLVSLLKKN  NVRCLYLKSTMGP +R+F
Sbjct:  107 FHAFLASESVIKQIPRLLGPGLNKAGKFPTLVSHQESLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIFQNVQMSVNFLVSLLKKNWQNVRCLYLKSTMGPPNRVF 217          
BLAST of CB304385 vs. ExPASy Swiss-Prot
Match: R10A2_ARATH (60S ribosomal protein L10a-2 OS=Arabidopsis thaliana GN=RPL10AB PE=2 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 5.430e-53
Identity = 104/111 (93.69%), Postives = 107/111 (96.40%), Query Frame = -3
Query:  231 YHAFLASESVIKQIPRLLGPGLNKAGKFPTLVTHQESLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIFQNVQMSVNFLVSLLKKNXXNVRCLYLKSTMGPSSRIF 563
            YHAFLASESVIKQIPRLLGPGLNKAGKFPTLV+HQESLE+KVNETKATVKFQLKKVLCMGVAVGNLSMEEKQ+FQNVQMSVNFLVSLLKKN  NVRCLYLKSTMGP  RIF
Sbjct:  106 YHAFLASESVIKQIPRLLGPGLNKAGKFPTLVSHQESLEAKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQLFQNVQMSVNFLVSLLKKNWQNVRCLYLKSTMGPPQRIF 216          
BLAST of CB304385 vs. ExPASy Swiss-Prot
Match: RL10A_DANRE (60S ribosomal protein L10a OS=Danio rerio GN=rpl10a PE=2 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 6.444e-38
Identity = 73/111 (65.77%), Postives = 95/111 (85.59%), Query Frame = -3
Query:  231 YHAFLASESVIKQIPRLLGPGLNKAGKFPTLVTHQESLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIFQNVQMSVNFLVSLLKKNXXNVRCLYLKSTMGPSSRIF 563
            Y AFLASES+IKQIPR+LGPGLNKAGKFP+L+TH E+L +KV+E K+T+KFQ+KKVLC+ VAVG++ M E+++  N+ ++VNFLVSLLKKN  NVR LY+KSTMG   R++
Sbjct:  106 YDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENLGTKVDEVKSTIKFQMKKVLCLAVAVGHVKMSEEELVYNIHLAVNFLVSLLKKNWQNVRALYIKSTMGKPQRLY 216          
BLAST of CB304385 vs. ExPASy Swiss-Prot
Match: RL10A_XENLA (60S ribosomal protein L10a OS=Xenopus laevis GN=rpl10a PE=2 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 1.099e-37
Identity = 72/111 (64.86%), Postives = 95/111 (85.59%), Query Frame = -3
Query:  231 YHAFLASESVIKQIPRLLGPGLNKAGKFPTLVTHQESLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIFQNVQMSVNFLVSLLKKNXXNVRCLYLKSTMGPSSRIF 563
            Y AFLASES+IKQIPR+LGPGLNKAGKFP+L+TH E+L +KV+E K+T+KFQ+KKVLC+ VAVG++ + E+++  N+ +S+NFLVSLLKKN  NVR LY+KSTMG   R++
Sbjct:  107 YDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENLVAKVDEVKSTIKFQMKKVLCLAVAVGHVKLTEEELVYNIHLSINFLVSLLKKNWQNVRALYIKSTMGKPQRLY 217          
BLAST of CB304385 vs. ExPASy Swiss-Prot
Match: R10AB_DROME (60S ribosomal protein L10a-2 OS=Drosophila melanogaster GN=RpL10Ab PE=1 SV=2)

HSP 1 Score: 156.377 bits (394), Expect = 1.099e-37
Identity = 73/111 (65.77%), Postives = 94/111 (84.68%), Query Frame = -3
Query:  231 YHAFLASESVIKQIPRLLGPGLNKAGKFPTLVTHQESLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIFQNVQMSVNFLVSLLKKNXXNVRCLYLKSTMGPSSRIF 563
            Y AFLASES+IKQIPRLLGPGLNKAGKFP L++HQES+  K+ E K+T+KFQ+KKVLC+ VAVG++ M+  ++ QNV +S+NFLVSLLKKN  NVR L++KS+MGP  R++
Sbjct:  107 YDAFLASESLIKQIPRLLGPGLNKAGKFPALLSHQESMIGKIEEVKSTIKFQMKKVLCLSVAVGHVGMKSDELAQNVNLSINFLVSLLKKNWQNVRSLHVKSSMGPPQRLY 217          
BLAST of CB304385 vs. ExPASy Swiss-Prot
Match: RL10A_SPOFR (60S ribosomal protein L10a OS=Spodoptera frugiperda GN=RpL10A PE=2 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 2.449e-37
Identity = 73/111 (65.77%), Postives = 94/111 (84.68%), Query Frame = -3
Query:  231 YHAFLASESVIKQIPRLLGPGLNKAGKFPTLVTHQESLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIFQNVQMSVNFLVSLLKKNXXNVRCLYLKSTMGPSSRIF 563
            Y AFLASES+IKQIPRLLGPGLNKAGKFP L++HQES+  K++E KAT+KFQ+KKVLC+ VAVG++ M   ++ QNV +S+NFLVSLLKK+  NVR L++KSTMGP  +++
Sbjct:  107 YDAFLASESLIKQIPRLLGPGLNKAGKFPGLLSHQESMTQKIDEVKATIKFQMKKVLCLSVAVGHVDMTPDELAQNVHLSINFLVSLLKKHWQNVRSLHMKSTMGPPPKLY 217          
BLAST of CB304385 vs. ExPASy Swiss-Prot
Match: RL10A_ICTPU (60S ribosomal protein L10a OS=Ictalurus punctatus GN=rpl10a PE=2 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 2.449e-37
Identity = 72/111 (64.86%), Postives = 94/111 (84.68%), Query Frame = -3
Query:  231 YHAFLASESVIKQIPRLLGPGLNKAGKFPTLVTHQESLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIFQNVQMSVNFLVSLLKKNXXNVRCLYLKSTMGPSSRIF 563
            Y AFLASES+IKQIPR+LGPGLNKAGKFP+L+TH E+L +KV+E K+T+KFQ+KKVLC+ VAVG++ M E ++  N+ ++VNFLVSLLKKN  NVR LY+KS+MG   R++
Sbjct:  106 YDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENLNTKVDEVKSTIKFQMKKVLCLAVAVGHVRMSEDELVYNIHLAVNFLVSLLKKNWQNVRALYIKSSMGKPQRLY 216          
BLAST of CB304385 vs. ExPASy Swiss-Prot
Match: RL10A_RAT (60S ribosomal protein L10a OS=Rattus norvegicus GN=Rpl10a PE=1 SV=2)

HSP 1 Score: 154.066 bits (388), Expect = 5.455e-37
Identity = 71/111 (63.96%), Postives = 94/111 (84.68%), Query Frame = -3
Query:  231 YHAFLASESVIKQIPRLLGPGLNKAGKFPTLVTHQESLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIFQNVQMSVNFLVSLLKKNXXNVRCLYLKSTMGPSSRIF 563
            Y AFLASES+IKQIPR+LGPGLNKAGKFP+L+TH E++ +KV+E K+T+KFQ+KKVLC+ VAVG++ M + ++  N+ ++VNFLVSLLKKN  NVR LY+KSTMG   R++
Sbjct:  107 YDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENMVAKVDEVKSTIKFQMKKVLCLAVAVGHVKMTDDELVYNIHLAVNFLVSLLKKNWQNVRALYIKSTMGKPQRLY 217          
BLAST of CB304385 vs. ExPASy Swiss-Prot
Match: RL10A_MOUSE (60S ribosomal protein L10a OS=Mus musculus GN=Rpl10a PE=1 SV=3)

HSP 1 Score: 154.066 bits (388), Expect = 5.455e-37
Identity = 71/111 (63.96%), Postives = 94/111 (84.68%), Query Frame = -3
Query:  231 YHAFLASESVIKQIPRLLGPGLNKAGKFPTLVTHQESLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIFQNVQMSVNFLVSLLKKNXXNVRCLYLKSTMGPSSRIF 563
            Y AFLASES+IKQIPR+LGPGLNKAGKFP+L+TH E++ +KV+E K+T+KFQ+KKVLC+ VAVG++ M + ++  N+ ++VNFLVSLLKKN  NVR LY+KSTMG   R++
Sbjct:  107 YDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENMVAKVDEVKSTIKFQMKKVLCLAVAVGHVKMTDDELVYNIHLAVNFLVSLLKKNWQNVRALYIKSTMGKPQRLY 217          
The following BLAST results are available for this feature:
BLAST of CB304385 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 28
Match NameE-valueIdentityDescription
R10A1_ARATH1.429e-5395.5060S ribosomal protein L10a-1 OS=Arabidopsis thalia... [more]
R10A3_ARATH4.157e-5393.6960S ribosomal protein L10a-3 OS=Arabidopsis thalia... [more]
R10A2_ARATH5.430e-5393.6960S ribosomal protein L10a-2 OS=Arabidopsis thalia... [more]
RL10A_DANRE6.444e-3865.7760S ribosomal protein L10a OS=Danio rerio GN=rpl10... [more]
RL10A_XENLA1.099e-3764.8660S ribosomal protein L10a OS=Xenopus laevis GN=rp... [more]
R10AB_DROME1.099e-3765.7760S ribosomal protein L10a-2 OS=Drosophila melanog... [more]
RL10A_SPOFR2.449e-3765.7760S ribosomal protein L10a OS=Spodoptera frugiperd... [more]
RL10A_ICTPU2.449e-3764.8660S ribosomal protein L10a OS=Ictalurus punctatus ... [more]
RL10A_RAT5.455e-3763.9660S ribosomal protein L10a OS=Rattus norvegicus GN... [more]
RL10A_MOUSE5.455e-3763.9660S ribosomal protein L10a OS=Mus musculus GN=Rpl1... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0001_IIIaR_A10 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0001_IIIaR_A10 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304385 ID=CB304385|Name=CB304385|organism=Citrus sinensis|type=EST|length=625bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTATTTCAATTCAACATCTCTCCA
ACAAAAAAATTCGTACAAGCCTACCATATTATAAGATTACTAGGGCATTA
AATTCAGAAAAGAAAAAGAAAAAGAAAAAGAAAATTGCAGGTTGGGACCA
TTCAAAGAAAGACATTTTGGGTATAATAAGATCACACTAGGTTTTCCCTA
CAAAACTCCAACATAAAGCAGAATTTCTTAAAAGATGCGGCTTGAAGGAC
CCATGGTACTCTTCAGATAGAGGCACCTGACATTCNNNCAGTTTTTCTTC
AACAATGAGACAAGGAAGTTAACACTCATTTGAACATTCTGGAAGATCTG
CTTCTCCTCCATTGAAAGGTTTCCAACAGCAACTCCCATGCAAAGCACCT
TCTTCAATTGGAACTTCACTGTTGCCTTAGTCTCGTTGACTTTGGACTCC
AGGGATTCTTGGTGAGTAACAAGGGTAGGGAACTTTCCTGCCTTGTTGAG
ACCAGGACCCAACAAACGAGGAATCTGCTTGATGACAGACTCTGATGCCA
AGAAAGCATGATATTTCTTGGCAAGTTTCTTCACCAATTTCTTGTTCTTG
TTCAATTTTTTCAATCCCTTCACAT
back to top