CB304393

Overview
NameCB304393
Unique NameCB304393
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length653
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2038 contig Csv1_Contig2038:37..689. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB304393 vs. ExPASy Swiss-Prot
Match: G3PC_TOBAC (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic (Fragment) OS=Nicotiana tabacum GN=GAPC PE=2 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 4.921e-47
Identity = 93/103 (90.29%), Postives = 98/103 (95.15%), Query Frame = -3
Query:  343 GMAFRVPTVDVSVVDLTVRLEKDASYDEIKAAIKAESEGKLKGILGYTEDDVVSTDFVGDSRSSIFGAKAGIVLSKKFVKLVSWYDNEWGYSTRVVDLIVHMA 651
            GMAFRVPTVDVSVVDLTVRLEK+ASYD+IKAAIK ESEGKLKGILG+TEDDVVSTDFVGDSRSSIF AKAGI LSK FVKLVSWYDNEWGYS+RV+DLI HMA
Sbjct:  221 GMAFRVPTVDVSVVDLTVRLEKEASYDDIKAAIKEESEGKLKGILGFTEDDVVSTDFVGDSRSSIFDAKAGIALSKNFVKLVSWYDNEWGYSSRVIDLICHMA 323          
BLAST of CB304393 vs. ExPASy Swiss-Prot
Match: G3PC_GINBI (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Ginkgo biloba PE=2 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 8.393e-47
Identity = 93/105 (88.57%), Postives = 97/105 (92.38%), Query Frame = -3
Query:  337 GMAFRVPTVDVSVVDLTVRLEKDASYDEIKAAIKAESEGKLKGILGYTEDDVVSTDFVGDSRSSIFGAKAGIVLSKKFVKLVSWYDNEWGYSTRVVDLIVHMAKT 651
            GMAFRVPT DVSVVDLTVRLEK ASYDEIKAAIK ESEGKLKGILGYTEDDVVSTDF+GD+RSSIF AKAGI LS  FVKLVSWYDNEWGYS+RV+DLIVHMA T
Sbjct:  235 GMAFRVPTPDVSVVDLTVRLEKPASYDEIKAAIKEESEGKLKGILGYTEDDVVSTDFIGDNRSSIFDAKAGIALSDNFVKLVSWYDNEWGYSSRVIDLIVHMAST 339          
BLAST of CB304393 vs. ExPASy Swiss-Prot
Match: G3PC_ANTMA (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Antirrhinum majus GN=GAPC PE=2 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 1.096e-46
Identity = 93/106 (87.74%), Postives = 98/106 (92.45%), Query Frame = -3
Query:  334 GMAFRVPTVDVSVVDLTVRLEKDASYDEIKAAIKAESEGKLKGILGYTEDDVVSTDFVGDSRSSIFGAKAGIVLSKKFVKLVSWYDNEWGYSTRVVDLIVHMAKTQ 651
            GM+FRVPTVDVSVVDLTVRLEK A+Y++IKAAIK ESEGKLKGILGYTEDDVVSTDFVGDSRSSIF AKAGI L+  FVKLVSWYDNEWGYSTRVVDLIVHMA  Q
Sbjct:  232 GMSFRVPTVDVSVVDLTVRLEKKATYEQIKAAIKEESEGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALNDNFVKLVSWYDNEWGYSTRVVDLIVHMASVQ 337          
BLAST of CB304393 vs. ExPASy Swiss-Prot
Match: G3PC_ARATH (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Arabidopsis thaliana GN=GAPC PE=2 SV=2)

HSP 1 Score: 186.037 bits (471), Expect = 1.432e-46
Identity = 93/104 (89.42%), Postives = 98/104 (94.23%), Query Frame = -3
Query:  340 GMAFRVPTVDVSVVDLTVRLEKDASYDEIKAAIKAESEGKLKGILGYTEDDVVSTDFVGDSRSSIFGAKAGIVLSKKFVKLVSWYDNEWGYSTRVVDLIVHMAK 651
            GM+FRVPTVDVSVVDLTVRLEK A+YDEIK AIK ESEGKLKGILGYTEDDVVSTDFVGD+RSSIF AKAGI LS KFVKLVSWYDNEWGYS+RVVDLIVHM+K
Sbjct:  234 GMSFRVPTVDVSVVDLTVRLEKAATYDEIKKAIKEESEGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSDKFVKLVSWYDNEWGYSSRVVDLIVHMSK 337          
BLAST of CB304393 vs. ExPASy Swiss-Prot
Match: G3PC_PINSY (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Pinus sylvestris GN=GAPC PE=2 SV=1)

HSP 1 Score: 184.496 bits (467), Expect = 4.166e-46
Identity = 93/106 (87.74%), Postives = 97/106 (91.51%), Query Frame = -3
Query:  334 GMAFRVPTVDVSVVDLTVRLEKDASYDEIKAAIKAESEGKLKGILGYTEDDVVSTDFVGDSRSSIFGAKAGIVLSKKFVKLVSWYDNEWGYSTRVVDLIVHMAKTQ 651
            GMAFRVPT DVSVVDLTVRLEK A+YDEIKAAIKAESEG LKGILGYTED VVSTDF+GDSRSSIF A+AGI LS  FVKLVSWYDNEWGYS+RVVDLIVHMA TQ
Sbjct:  235 GMAFRVPTPDVSVVDLTVRLEKSATYDEIKAAIKAESEGNLKGILGYTEDAVVSTDFIGDSRSSIFDAQAGIALSDNFVKLVSWYDNEWGYSSRVVDLIVHMAATQ 340          
BLAST of CB304393 vs. ExPASy Swiss-Prot
Match: G3PC_SINAL (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Sinapis alba GN=GAPC PE=2 SV=2)

HSP 1 Score: 184.111 bits (466), Expect = 5.440e-46
Identity = 91/104 (87.50%), Postives = 97/104 (93.27%), Query Frame = -3
Query:  340 GMAFRVPTVDVSVVDLTVRLEKDASYDEIKAAIKAESEGKLKGILGYTEDDVVSTDFVGDSRSSIFGAKAGIVLSKKFVKLVSWYDNEWGYSTRVVDLIVHMAK 651
            GM+FRVPTVDVSVVDLTVRLEK A+YDEIK AIK ES+GKLKGILGYTEDDVVSTDFVGD+RSSIF AKAGI LS  FVKLVSWYDNEWGYSTRVVDLI+HM+K
Sbjct:  234 GMSFRVPTVDVSVVDLTVRLEKAATYDEIKKAIKEESQGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSDNFVKLVSWYDNEWGYSTRVVDLIIHMSK 337          
BLAST of CB304393 vs. ExPASy Swiss-Prot
Match: G3PC_PEA (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Pisum sativum GN=GAPC1 PE=2 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 1.583e-45
Identity = 92/104 (88.46%), Postives = 98/104 (94.23%), Query Frame = -3
Query:  340 GMAFRVPTVDVSVVDLTVRLEKDASYDEIKAAIKAESEGKLKGILGYTEDDVVSTDFVGDSRSSIFGAKAGIVLSKKFVKLVSWYDNEWGYSTRVVDLIVHMAK 651
            GM+FRVPTVDVSVVDLTVRLEK A+YDEIKAAIK ESEGKLKGILGYTEDDVVSTDF+GD+RSSIF AKAGI L+ KFVKLVSWYDNE GYSTRVVDLIVH+AK
Sbjct:  233 GMSFRVPTVDVSVVDLTVRLEKAATYDEIKAAIKEESEGKLKGILGYTEDDVVSTDFIGDTRSSIFDAKAGIALNDKFVKLVSWYDNELGYSTRVVDLIVHIAK 336          
BLAST of CB304393 vs. ExPASy Swiss-Prot
Match: G3PC_CRAPL (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Craterostigma plantagineum GN=GAPC PE=2 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 2.067e-45
Identity = 91/103 (88.35%), Postives = 97/103 (94.17%), Query Frame = -3
Query:  343 GMAFRVPTVDVSVVDLTVRLEKDASYDEIKAAIKAESEGKLKGILGYTEDDVVSTDFVGDSRSSIFGAKAGIVLSKKFVKLVSWYDNEWGYSTRVVDLIVHMA 651
            GMAFRVPTVDVSVVDLTV L K+ASYDEIKAAIK ESEGKLKGILGYTE+DVVS+DFVGDSRSSIF AKAGI LSKKFVK+V+WYDNEWGYS+RVVDLI HMA
Sbjct:  232 GMAFRVPTVDVSVVDLTVTLAKEASYDEIKAAIKEESEGKLKGILGYTEEDVVSSDFVGDSRSSIFDAKAGIALSKKFVKIVAWYDNEWGYSSRVVDLIRHMA 334          
BLAST of CB304393 vs. ExPASy Swiss-Prot
Match: G3P_ATRNU (Glyceraldehyde-3-phosphate dehydrogenase OS=Atriplex nummularia PE=2 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 3.526e-45
Identity = 89/105 (84.76%), Postives = 99/105 (94.29%), Query Frame = -3
Query:  337 GMAFRVPTVDVSVVDLTVRLEKDASYDEIKAAIKAESEGKLKGILGYTEDDVVSTDFVGDSRSSIFGAKAGIVLSKKFVKLVSWYDNEWGYSTRVVDLIVHMAKT 651
            GM+FRVPTVDVSVVDLTVRLEK+A+Y++IKAAIK ESEGK+KGILGYTEDDVVSTDFVGD+RSSIF AKAGI L+  FVKLVSWYDNEWGYS+RVVDLI HM+KT
Sbjct:  232 GMSFRVPTVDVSVVDLTVRLEKEATYEQIKAAIKEESEGKMKGILGYTEDDVVSTDFVGDNRSSIFDAKAGICLNGNFVKLVSWYDNEWGYSSRVVDLIRHMSKT 336          
BLAST of CB304393 vs. ExPASy Swiss-Prot
Match: G3PC_DIACA (Glyceraldehyde-3-phosphate dehydrogenase, cytosolic OS=Dianthus caryophyllus GN=GAPC PE=3 SV=1)

HSP 1 Score: 180.259 bits (456), Expect = 7.856e-45
Identity = 87/105 (82.86%), Postives = 97/105 (92.38%), Query Frame = -3
Query:  337 GMAFRVPTVDVSVVDLTVRLEKDASYDEIKAAIKAESEGKLKGILGYTEDDVVSTDFVGDSRSSIFGAKAGIVLSKKFVKLVSWYDNEWGYSTRVVDLIVHMAKT 651
            GM+FRVPTVDVSVVDLTVR+EK A+Y+++KAAIK ESEGKLKGILGYTEDDVVSTDFVGD+RSSIF AKAGI L+  F+KLVSWYDNEWGYSTRVVDLI H+ KT
Sbjct:  232 GMSFRVPTVDVSVVDLTVRIEKPATYEQVKAAIKEESEGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALNDNFIKLVSWYDNEWGYSTRVVDLIAHIHKT 336          
The following BLAST results are available for this feature:
BLAST of CB304393 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 342
Match NameE-valueIdentityDescription
G3PC_TOBAC4.921e-4790.29Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_GINBI8.393e-4788.57Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_ANTMA1.096e-4687.74Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_ARATH1.432e-4689.42Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_PINSY4.166e-4687.74Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_SINAL5.440e-4687.50Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_PEA1.583e-4588.46Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3PC_CRAPL2.067e-4588.35Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]
G3P_ATRNU3.526e-4584.76Glyceraldehyde-3-phosphate dehydrogenase OS=Atripl... [more]
G3PC_DIACA7.856e-4582.86Glyceraldehyde-3-phosphate dehydrogenase, cytosoli... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0001_IIIaR_B10 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0001_IIIaR_B10 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304393 ID=CB304393|Name=CB304393|organism=Citrus sinensis|type=EST|length=653bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTCGCAGCTGAAGAACAGGTCTT
CGATACTAACTAGATGAAAAATTATAAAAGCAAGTTTCCAATAGACAATT
GTTTTCTCGCTAACAAAACATAAGTTGGTTCACCAACTCTTCTTGCATAC
TACAAGGGAAAATCTAAGCACAACCCTGCATGAGCAGGTAAGGCTCTGGA
TAATGTCTTGGAAACAATTTTATTTAAACTCAGACCCTCTACATAGAAAC
ACAAACACCACATTTAGCGCAAAGAAACACCACACTTAGCACAACTAAGC
GTGTTACATACTCAAGCCACGCCGAGTAAGTTACTGGGTCTTCGCCATGT
GGACAATCAAATCCACCACACGAGTACTGTAGCCCCACTCATTGTCATAC
CATGAGACAAGCTTCACAAATTTCTTACTCAAAACAATACCAGCCTTGGC
ACCAAAGATACTTGACCTACTGTCACCAACAAAGTCGGTGGATACCACAT
CATCCTCAGTGTATCCCAAGATACCCTTTAGTTTCCCCTCTGACTCCGCC
TTGATGGCAGCTTTGATTTCATCATAAGAAGCGTCCTTCTCCAGCCTCAC
TGTGAGGTCAACCACTGAGACATCAACAGTGGGTACACGGAAAGCCATAC
CAG
back to top