CB304394

Overview
NameCB304394
Unique NameCB304394
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length586
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig13846 contig Csv1_Contig13846:1..560. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB304394 vs. ExPASy Swiss-Prot
Match: HSP71_ARATH (Heat shock cognate 70 kDa protein 1 OS=Arabidopsis thaliana GN=HSC70-1 PE=1 SV=3)

HSP 1 Score: 198.364 bits (503), Expect = 2.213e-50
Identity = 103/135 (76.30%), Postives = 113/135 (83.70%), Query Frame = -3
Query:  192 EEIEKMVQEAEKYKAEDDEHKKKVEAKNALENYAYNMRNTIKDEKISAKLPTADKKKIEDAIEEAIQWLDGNQLAEADEFEDKMKELECICNPIIAKMYQGGGADAG----ASMDEDXXXXXXXXXXXPKIEEVD 584
            +EIEKMVQEAEKYK+ED+EHKKKVEAKNALENYAYNMRNTI+DEKI  KLP ADKKKIED+IE+AIQWL+GNQLAEADEFEDKMKELE ICNPIIAKMYQG G +AG    + MD+D           PKIEEVD
Sbjct:  519 DEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIQDEKIGEKLPAADKKKIEDSIEQAIQWLEGNQLAEADEFEDKMKELESICNPIIAKMYQGAGGEAGGPGASGMDDD--APPASGGAGPKIEEVD 651          
BLAST of CB304394 vs. ExPASy Swiss-Prot
Match: HSP72_ARATH (Heat shock cognate 70 kDa protein 2 OS=Arabidopsis thaliana GN=HSC70-2 PE=2 SV=2)

HSP 1 Score: 197.978 bits (502), Expect = 2.890e-50
Identity = 104/136 (76.47%), Postives = 113/136 (83.09%), Query Frame = -3
Query:  192 EEIEKMVQEAEKYKAEDDEHKKKVEAKNALENYAYNMRNTIKDEKISAKLPTADKKKIEDAIEEAIQWLDGNQLAEADEFEDKMKELECICNPIIAKMYQGG-GADAG----ASMDEDXXXXXXXXXXXPKIEEVD 584
            E+IEKMVQEAEKYK+ED+EHKKKVEAKNALENYAYNMRNTI+DEKI  KLP ADKKK+ED+IEEAIQWLDGNQL EADEFEDKMKELE +CNPIIAKMYQGG G +AG    + MDED           PKIEEVD
Sbjct:  519 EDIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIRDEKIGEKLPAADKKKVEDSIEEAIQWLDGNQLGEADEFEDKMKELESVCNPIIAKMYQGGAGGEAGGPGASGMDED-EAPPASGGAGPKIEEVD 653          
BLAST of CB304394 vs. ExPASy Swiss-Prot
Match: HSP7E_SPIOL (Chloroplast envelope membrane 70 kDa heat shock-related protein OS=Spinacia oleracea GN=SCE70 PE=1 SV=3)

HSP 1 Score: 191.815 bits (486), Expect = 2.071e-48
Identity = 91/113 (80.53%), Postives = 102/113 (90.27%), Query Frame = -3
Query:  246 EEIEKMVQEAEKYKAEDDEHKKKVEAKNALENYAYNMRNTIKDEKISAKLPTADKKKIEDAIEEAIQWLDGNQLAEADEFEDKMKELECICNPIIAKMYQGGGADAGASMDED 584
            EEIEKMVQEAEKYK+ED+EHKKKVE+KNALENYAYNMRN +KDEKI AKL  ADKKKIE+AI+ +IQWLDGNQLAEADEF+DKMKELE ICNPIIAKMYQG G D G  M+++
Sbjct:  519 EEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRNIVKDEKIGAKLSEADKKKIEEAIDASIQWLDGNQLAEADEFDDKMKELESICNPIIAKMYQGAGGDMGGGMEDE 631          
BLAST of CB304394 vs. ExPASy Swiss-Prot
Match: HSP71_SOLLC (Heat shock cognate 70 kDa protein 1 OS=Solanum lycopersicum GN=HSC-I PE=2 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 2.071e-48
Identity = 98/131 (74.81%), Postives = 108/131 (82.44%), Query Frame = -3
Query:  192 EEIEKMVQEAEKYKAEDDEHKKKVEAKNALENYAYNMRNTIKDEKISAKLPTADKKKIEDAIEEAIQWLDGNQLAEADEFEDKMKELECICNPIIAKMYQGGGADAGASMDEDXXXXXXXXXXXPKIEEVD 584
            EEIEKMVQEAEKYKAED+E KKKVEAKN+LENYAYNMRNT+KDEKI +KL + DKKKIEDA+++AI WL+ NQLAE DEFEDKMKELE ICNPIIAKMYQG G DAG  MD+D           PKIEEVD
Sbjct:  521 EEIEKMVQEAEKYKAEDEELKKKVEAKNSLENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAVDQAISWLESNQLAEVDEFEDKMKELEGICNPIIAKMYQGAGGDAGVPMDDD-APPSGGSSAGPKIEEVD 650          
BLAST of CB304394 vs. ExPASy Swiss-Prot
Match: HSP72_SOLLC (Heat shock cognate 70 kDa protein 2 OS=Solanum lycopersicum GN=HSC-2 PE=2 SV=1)

HSP 1 Score: 190.274 bits (482), Expect = 6.026e-48
Identity = 98/131 (74.81%), Postives = 107/131 (81.68%), Query Frame = -3
Query:  192 EEIEKMVQEAEKYKAEDDEHKKKVEAKNALENYAYNMRNTIKDEKISAKLPTADKKKIEDAIEEAIQWLDGNQLAEADEFEDKMKELECICNPIIAKMYQGGGADAGASMDEDXXXXXXXXXXXPKIEEVD 584
            EEIEKMVQEAEKYK+ED+EHKKKVEAKNALENYAYNMRNTIKDEKI++KL   D+ KIEDAIE+AIQWLDGNQLAEA+EFEDKMKELE +CNPIIAKMYQG G D      +D           PKIEEVD
Sbjct:  519 EEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIKDEKIASKLSADDRTKIEDAIEQAIQWLDGNQLAEAEEFEDKMKELESLCNPIIAKMYQGAGGDM-----DDEGPAPSGGGAGPKIEEVD 644          
BLAST of CB304394 vs. ExPASy Swiss-Prot
Match: HSP7C_PETHY (Heat shock cognate 70 kDa protein OS=Petunia hybrida GN=HSP70 PE=2 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 2.290e-47
Identity = 100/135 (74.07%), Postives = 111/135 (82.22%), Query Frame = -3
Query:  192 EEIEKMVQEAEKYKAEDDEHKKKVEAKNALENYAYNMRNTIKDEKISAKLPTADKKKIEDAIEEAIQWLDGNQLAEADEFEDKMKELECICNPIIAKMYQGGGADAGASMDED----XXXXXXXXXXXPKIEEVD 584
            EEIE+MVQEAEKYK+ED+E KKKVEAKNALENYAYNMRNTIKD+KI+++L  ADKK+IEDAI+EAI+WLD NQLAEADEFEDKMKELE ICNPIIAKMYQGG    GA+MDED               PKIEEVD
Sbjct:  519 EEIERMVQEAEKYKSEDEELKKKVEAKNALENYAYNMRNTIKDDKINSQLSAADKKRIEDAIDEAIKWLDNNQLAEADEFEDKMKELESICNPIIAKMYQGGA--GGATMDEDGPSVGGSAGSQTGAGPKIEEVD 651          
BLAST of CB304394 vs. ExPASy Swiss-Prot
Match: HSP70_MAIZE (Heat shock 70 kDa protein OS=Zea mays GN=HSP70 PE=3 SV=2)

HSP 1 Score: 186.808 bits (473), Expect = 6.662e-47
Identity = 96/131 (73.28%), Postives = 105/131 (80.15%), Query Frame = -3
Query:  192 EEIEKMVQEAEKYKAEDDEHKKKVEAKNALENYAYNMRNTIKDEKISAKLPTADKKKIEDAIEEAIQWLDGNQLAEADEFEDKMKELECICNPIIAKMYQGGGADAGASMDEDXXXXXXXXXXXPKIEEVD 584
            EEIEKMVQEAEKYKAED+E KKKV+AKNALENYAYNMRNTIKD+KI++KLP  DKKKIEDA++ AI WLD NQLAE +EFEDKMKELE ICNPIIAKMY G GA  GA+   D           PKIEEVD
Sbjct:  515 EEIEKMVQEAEKYKAEDEEVKKKVDAKNALENYAYNMRNTIKDDKIASKLPAEDKKKIEDAVDGAISWLDSNQLAEVEEFEDKMKELEGICNPIIAKMYXGEGAGMGAAAGMDEDAPSGGSGAGPKIEEVD 645          
BLAST of CB304394 vs. ExPASy Swiss-Prot
Match: HSP73_ARATH (Heat shock cognate 70 kDa protein 3 OS=Arabidopsis thaliana GN=HSC70-3 PE=1 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 1.484e-46
Identity = 98/133 (73.68%), Postives = 106/133 (79.70%), Query Frame = -3
Query:  192 EEIEKMVQEAEKYKAEDDEHKKKVEAKNALENYAYNMRNTIKDEKISAKLPTADKKKIEDAIEEAIQWLDGNQLAEADEFEDKMKELECICNPIIAKMYQGG--GADAGASMDEDXXXXXXXXXXXPKIEEVD 584
            +EIEKMVQEAEKYK+ED+EHKKKV+AKNALENYAYNMRNTI+DEKI  KL   DKKKIED+IE AI+WL+ NQLAE DEFEDKMKELE ICNPIIAKMYQGG  G  A   MDED           PKIEEVD
Sbjct:  519 DEIEKMVQEAEKYKSEDEEHKKKVDAKNALENYAYNMRNTIRDEKIGEKLAGDDKKKIEDSIEAAIEWLEANQLAECDEFEDKMKELESICNPIIAKMYQGGEAGGPAAGGMDED--VPPSAGGAGPKIEEVD 649          
BLAST of CB304394 vs. ExPASy Swiss-Prot
Match: HSP70_SOYBN (Heat shock 70 kDa protein OS=Glycine max GN=HSP70 PE=3 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 3.783e-42
Identity = 90/131 (68.70%), Postives = 101/131 (77.10%), Query Frame = -3
Query:  192 EEIEKMVQEAEKYKAEDDEHKKKVEAKNALENYAYNMRNTIKDEKISAKLPTADKKKIEDAIEEAIQWLDGNQLAEADEFEDKMKELECICNPIIAKMYQGGGADAGASMDEDXXXXXXXXXXXPKIEEVD 584
            EEIEKMV++AE+YKAED+E KKKVEAKN+LENYAYNMRNTIKDEKI  KL   +K+KIE A+E+AIQWL+GNQ+AE DEFEDK KELE ICNPIIAKMYQG    AG   D             PKIEEVD
Sbjct:  518 EEIEKMVKDAERYKAEDEEVKKKVEAKNSLENYAYNMRNTIKDEKIGGKLSPDEKQKIEKAVEDAIQWLEGNQMAEVDEFEDKQKELEGICNPIIAKMYQGA---AGPGGDVPMGADMPAAGAGPKIEEVD 645          
BLAST of CB304394 vs. ExPASy Swiss-Prot
Match: HSP70_LUPPO (Heat shock 70 kDa protein (Fragment) OS=Lupinus polyphyllus PE=2 SV=2)

HSP 1 Score: 162.155 bits (409), Expect = 1.757e-39
Identity = 78/101 (77.23%), Postives = 89/101 (88.12%), Query Frame = -3
Query:  282 EEIEKMVQEAEKYKAEDDEHKKKVEAKNALENYAYNMRNTIKDEKISAKLPTADKKKIEDAIEEAIQWLDGNQLAEADEFEDKMKELECICNPIIAKMYQG 584
            E+IEKMVQE EKYKAED+E KKKV+ KNALENYAY+MRNTI D+KI++KLPT DKKKIED ++ AI  LDGNQL E +EFEDKMKELE +CNPIIAKMYQG
Sbjct:  127 EDIEKMVQEVEKYKAEDEEVKKKVDTKNALENYAYSMRNTITDDKITSKLPTEDKKKIEDTVDGAISRLDGNQLPEVEEFEDKMKELESLCNPIIAKMYQG 227          
The following BLAST results are available for this feature:
BLAST of CB304394 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 166
Match NameE-valueIdentityDescription
HSP71_ARATH2.213e-5076.30Heat shock cognate 70 kDa protein 1 OS=Arabidopsis... [more]
HSP72_ARATH2.890e-5076.47Heat shock cognate 70 kDa protein 2 OS=Arabidopsis... [more]
HSP7E_SPIOL2.071e-4880.53Chloroplast envelope membrane 70 kDa heat shock-re... [more]
HSP71_SOLLC2.071e-4874.81Heat shock cognate 70 kDa protein 1 OS=Solanum lyc... [more]
HSP72_SOLLC6.026e-4874.81Heat shock cognate 70 kDa protein 2 OS=Solanum lyc... [more]
HSP7C_PETHY2.290e-4774.07Heat shock cognate 70 kDa protein OS=Petunia hybri... [more]
HSP70_MAIZE6.662e-4773.28Heat shock 70 kDa protein OS=Zea mays GN=HSP70 PE=... [more]
HSP73_ARATH1.484e-4673.68Heat shock cognate 70 kDa protein 3 OS=Arabidopsis... [more]
HSP70_SOYBN3.783e-4268.70Heat shock 70 kDa protein OS=Glycine max GN=HSP70 ... [more]
HSP70_LUPPO1.757e-3977.23Heat shock 70 kDa protein (Fragment) OS=Lupinus po... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0001_IIIaR_B11 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0001_IIIaR_B11 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304394 ID=CB304394|Name=CB304394|organism=Citrus sinensis|type=EST|length=586bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTCCTGAAGGAAAAATAAGACA
TTGCTTAAAAACATAATATCTTTATGCATACACCAGGAAACAGTATTTAC
ATGTAACAGAAGCAGGAAAAGGAAGAAAAGATCACACCCCCAACTCAACC
CCTAATCATTAAACAACATTAAGCATAAATCCTCAAATTTAATCCACCTC
CTCAATCTTGGGGCCAGCACCGCTACCAGCACCAGCAGAAGGACCATCCT
CATCCATACTTGCACCAGCATCAGCTCCACCTCCTTGGTACATCTTGGCA
ATAATTGGGTTGCAGATGCACTCCAGCTCTTTCATCTTATCTTCAAACTC
ATCTGCCTCTGCGAGCTGGTTCCCGTCAAGCCATTGGATGGCCTCCTCAA
TGGCATCTTCAATTTTCTTCTTGTCAGCAGTGGGAAGCTTTGCGCTGATC
TTTTCATCCTTGATTGTGTTTCTCATGTTGTAAGCATAATTCTCAAGAGC
ATTCTTGGCCTCCACCTTTTTCTTGTGCTCGTCATCCTCGGCCTTGTATT
TTTCTGCCTCTTGTACCATCTTCTCTATCTCCTCCT
back to top